KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_4785Help
Entry
ECO26_4785        CDS       T01098                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECO26_4785 (hemD)
Enzymes [BR:eoj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECO26_4785 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4795201..4795941
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
MVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtctcccgctggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcggcgctgggggagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctgattatttcgccattggacgcaccaccgcactggcgctacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggataccctgacagcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
atggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacactgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system