KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5036Help
Entry
ECO26_5036        CDS       T01098                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:eoj00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eoj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5075789..5077111
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAAKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMAVALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHNLSPV
HQSGRQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctattttgaccagctcgatcgcgttcgttatgaaggctcaaaatcctcaaac
ccgttagcattccgtcactacaatcccgacgaactggtgttgggtaagcgtatggaagag
cacttgcgttttgccgcctgctactggcacaccttctgctggaacggggcggacatgttt
ggtgtgggggcgtttaatcgtccgtggcagcagcctggtgaggcactggcgttggcgaag
cgtaaagcagatgtcgcatttgagtttttccacaagttacatgtgccattttattgcttc
cacgatgtggatgtttcccctgagggcgcgtcgttaaaagagtacatcaataattttgcg
caaatggttgatgtcctggcagccaagcaagaagagagcggcgtgaagctgctgtgggga
accgctaactgctttacaaaccctcgctatggcgcgggtgcggcgacgaacccagatcct
gaagtcttcagctgggcggcaacgcaagttgttacagcgatggaagcaacccataaattg
ggcggtgaaaactatgtcctgtggggtggtcgtgaaggttacgaaacgctgttaaatacc
gacttgcgtcaggagcgtgaacaactgggccgctttatgcagatggtggttgagcataaa
cataaaatcggcttccagggcacgttgcttatcgaaccgaaaccgcaagaaccgactaaa
catcaatatgattacgatgccgcgacggtctatggcttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagctaaccacgcgacgctggcaggtcactctttccat
catgaaatagccaccgccattgcgcttggcctgttcggttctgtcgacgccaaccgtggc
gatgcgcaactgggctgggacaccgaccagttcccgaacagtgtggaagagaatgcgctg
gtgatgtatgaaattctcaaagcaggtggtttcaccaccggtggtctgaacttcgatgcc
aaagtacgtcgtcaaagtactgataaatatgatctgttttacggtcatatcggcgcgatg
gatacgatggcagtggcgctgaaaattgcagcgcgcatgattgaagatggcgagctggat
aaacgcatcgcgcagcgttattccggctggaatagcgaattgggccagcaaatcctgaaa
ggccaaatgtcactggcagatttagccaaatatgctcaggaacataatttgtctccggtg
catcagagtggtcgccaggagcaactggaaaatctggtaaatcattatctgttcgacaaa
taa

DBGET integrated database retrieval system