KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5118Help
Entry
ECO26_5118        CDS       T01098                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECO26_5118 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECO26_5118 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECO26_5118 (aceB)
Enzymes [BR:eoj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECO26_5118 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5180561..5182162
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFIRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRDTDWKIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcataaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaactttgcctgattttatttcggaaacagcttccattcgcgatacggactggaaaatt
cgtggtattcccgcggacttacaagatcgtcgagtcgagataactggcccggttgagcgc
aagatggtgatcaacgcactgaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggcaccagactggaacaaagtgatcgacgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctataccaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagctatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaaccattcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcagcgtttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaagcgctggaagccaataacggt
cacgatggcacatggattgctcacccaggccttgcggatacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctgctggcaccttgtgatggtgaacgcaccgaagaaggtatgcgcgcc
aacattcgcgtggcagtgcagtacatcgaagcatggatctccggcaacggctgcgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggtgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system