KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5169Help
Entry
ECO26_5169        CDS       T01098                                 

Gene name
alr
Definition
alanine racemase
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:eoj00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5239758..5240855
Genome map
AA seq 365 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVDL
SFCNI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcccctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtactgttactcgaaggc
ttttttgatgccagagatctgccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgcctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgtggcgcaaccgagaaacaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcatcgggtggcattctgctgtgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttatggcgtctcgccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcactaacctccagc
ctgattgccgtgcgtgagcataaagccggagaacctgttggttatggtggaacctgggta
agcgaacgtgatacccgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtaccgattgtcgggcgc
gtggcgatggatatgatctgcgtagacttaggtccacaagcgcaggacaaagccggggat
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agcgcttacgaacttattacgcgcctgacttcaagggtcgcgatgaaatacgtggattta
tcgttctgtaatatttga

DBGET integrated database retrieval system