KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5577Help
Entry
ECO26_5577        CDS       T01098                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ECO26_5577 (holD)
   00240 Pyrimidine metabolism
    ECO26_5577 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ECO26_5577 (holD)
   03430 Mismatch repair
    ECO26_5577 (holD)
   03440 Homologous recombination
    ECO26_5577 (holD)
Enzymes [BR:eoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ECO26_5577 (holD)
DNA replication proteins [BR:eoj03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ECO26_5577 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5664365..5664778
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggaaattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system