KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5577Help
Entry
ECO26_5577        CDS       T01098                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eoj00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eoj00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eoj03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eoj03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eoj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5664365..5664778
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggaaattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgatcaagtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcgctgcaacagctggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system