KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0050Help
Entry
G2583_0050        CDS       T01190                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eok00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:eok00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
54103..54693
Genome map
AA seq 196 aa AA seqDB search
MDSPAEYKIFLNIILAPVDDGLRFTYSGDNFFYREISMISLIAALAVDRVIGMENAMPWN
LPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIA
ACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDA
DAQNSHSYCFEILERR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtggactcgccagcagaatataaaattttcctcaacatcatcctcgcaccagtcgacgac
ggtttacgctttacgtatagtggcgacaattttttttatcgggaaatctcaatgatcagt
ctgattgcggcgttagcggtagatcgcgttatcggcatggaaaacgccatgccgtggaac
ctgcctgccgatctcgcctggtttaaacgcaacaccttaaataaacccgtaattatgggc
cgccatacctgggaatccatcggtcgtccgttgccaggacgcaaaaatattatcctcagc
agtcaaccgggtacggacgatcgcgtaacgtgggtgaagtcggtggatgaagccatcgcg
gcgtgtggtgacgtaccagaaatcatggtgattggcggcggtcgcgtttatgagcagttc
ctgccgaaagcgcaaaaactgtacctgacgcatatcgacgcagaagtggaaggcgacacc
cattttccggattacgagccggatgactgggaatcggtattcagcgaattccacgacgct
gatgcgcagaactctcacagctattgttttgagattctggagcggcggtaa

DBGET integrated database retrieval system