KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0146Help
Entry
G2583_0146        CDS       T01190                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    G2583_0146 (folK)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     G2583_0146 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161520..162002)
Genome map
AA seq 160 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGNETINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttaccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaacgcagccgtggcg
ctggaaacaacacttgcgcctgaagaattacttaatcacacacagcaaatagagttgcag
caaggtcgcgttcgtaaagcagaacgctggggaccgcgcacactcgatcttgatatcatg
ttgtttggtaatgaaaccattaataccgaacgactcaccgtcccgcattacgatatgaag
aatcgcggctttatgctgtggccgctgtttgagattgccccggaactcgtgtttcctgat
ggggagacattacgtgaaatactcacttcgctagcagtactacaacctgccatctggtat
tag

DBGET integrated database retrieval system