KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0481Help
Entry
G2583_0481        CDS       T01190                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00860  Porphyrin and chlorophyll metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
Module
eok_M00121  Heme biosynthesis, glutamate => heme
eok_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    G2583_0481 (hemB)
Enzymes [BR:eok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     G2583_0481 (hemB)
Exosome [BR:eok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G2583_0481 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: ADD55110
UniProt: D3QJE0
Structure
PDB: 

Jmol
Position
complement(489441..490448)
Genome map
AA seq 335 aa AA seqDB search
MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccttaattccacaaacatcaggcagaccatgacagacttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgcctggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtattcgttccgtgatgactttcggcatctctcaccataccgatgaaaccggc
agcgatgcctggcgggaagatggactggtagcgcgtatgtcgcgcatctgcaagcagacg
gtgccagaaatgattgtcatgtcagacacctgcttctgtgaatacacttctcacggtcac
tgcggtgtgctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagccgtggttgcagctgctgcaggtgcagacttcatcgccccttccgccgcgatggat
ggccaggtacaggcgattcgccaggcgctggacgctgctggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcctccttttatggtccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgtgaggcg
attcgtgagtcactgctggatgaagcccagggcgcagactgcctgatggttaaacctgct
ggagcgtacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtatgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcgattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system