KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0835Help
Entry
G2583_0835        CDS       T01190                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eok00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(867138..868802)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDKAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataaagccattctcgctcacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaacccacgtactggcggtaaacggtgaaatctacaat
caccaggcattgcgcgctgaatatggcgatcgttatcagttccagacagggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctca
gaaatgaaagccctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagtcaggacggcgaaattcgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggctctggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgcagcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttacactcctttgctgtaggtctgccgggttcaccggat
ctgaaagcagcccaggaagtggcaaaccatctgggcactgtgcatcatgaaattcacttc
actgtacaggaaggtctggacgccatccgcgacgtgatttaccacatcgaaacctatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaagcgatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgttcggcggttatctttac
ttccacaaagcaccgaatgccaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaagaaattcctcgacgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaagatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcaacagctggaaact
gcccgcttccgcttcccgtacaacacaccgacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactattcccgcttccgagcgccgctgagtgcgtgccgggcggtccttcc
gtcgcgtgttcttccgctaaagcgatcgaatgggatgaagcgttcaagaaaatggacgat
ccgtctggtcgcgcggttggtgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system