KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0883Help
Entry
G2583_0883        CDS       T01190                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00020  Citrate cycle (TCA cycle)
eok00640  Propanoate metabolism
eok00660  C5-Branched dibasic acid metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
Module
eok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G2583_0883 (sucC)
   00640 Propanoate metabolism
    G2583_0883 (sucC)
   00660 C5-Branched dibasic acid metabolism
    G2583_0883 (sucC)
Enzymes [BR:eok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     G2583_0883 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADD55494
UniProt: D3QMR0
Structure
PDB: 

Jmol
Position
928942..930108
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactgtttgcccgctatggcttaccagcaccg
gtgggttatgcctgtactactccgcgcgaagcagaagaagccgcttcaaaaatcggtgcc
ggtccgtgggtagtgaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagttgtaaacagcaaagaagacatccgtgcttttgcagaaaactggctgggcaagcgt
ctggtaacgtatcaaacagatgccaatggccaaccggttaaccagattctggttgaagca
gcgaccgatatcgctaaagagctgtatctcggtgccgttgtagaccgtagttcacgtcgc
gtggtctttatggcctccaccgaaggcggcgtggaaatcgaaaaagtggcggaagaaact
ccgcacctgatccacaaagttgcgcttgatccgctgactggcccgatgccgtatcaggga
cgcgagctggcgttcaaactgggtctggaaggtaaactggttcagcagttcaccaaaatc
ttcatgggcctggcgaccattttcctggagcgcgacctggcgctgatcgaaatcaacccg
ctggtcatcaccaaacagggcgatctgatttgcctcgacggcaaactgggcgctgatggc
aacgccctgttccgccagcctgatctgcgcgaaatgcgtgaccagtcgcaggaagatccg
cgtgaagcacaggctgcacagtgggaactgaactacgttgcgctggacggtaacatcggt
tgtatggttaacggcgcaggcctggcgatgggtacgatggacatcgttaaactgcacggc
ggcgaaccggctaacttcctggacgttggcggcggcgcaaccaaagaacgtgtaaccgaa
gcgttcaaaatcatcctctctgacgacaaagtgaaagccgttctggttaacatcttcggc
ggtatcgttcgttgcgacctgatcgctgacggtatcatcggtgcggtagcggaagtgggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcaaaaggtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system