KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0921Help
Entry
G2583_0921        CDS       T01190                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00010  Glycolysis / Gluconeogenesis
eok00260  Glycine, serine and threonine metabolism
eok00680  Methane metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
eok01230  Biosynthesis of amino acids
Module
eok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eok_M00002  Glycolysis, core module involving three-carbon compounds
eok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_0921 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    G2583_0921 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G2583_0921 (gpmA)
Enzymes [BR:eok01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     G2583_0921 (gpmA)
Membrane trafficking [BR:eok04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G2583_0921 (gpmA)
Exosome [BR:eok04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   G2583_0921 (gpmA)
  Exosomal proteins of melanoma cells
   G2583_0921 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADD55525
UniProt: D3QMU1
Structure
PDB: 

Jmol
Position
complement(960308..961060)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaaatatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcagccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system