KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0938Help
Entry
G2583_0938        CDS       T01190                                 

Gene name
ybhC
Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00040  Pentose and glucuronate interconversions
eok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    G2583_0938 (ybhC)
Enzymes [BR:eok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     G2583_0938 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: ADD55542
UniProt: D3QMV8
Structure
PDB: 

Jmol
Position
complement(979371..980654)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWGDAVISNRPFAGNTGSVDDSDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcttgtagctcaacaccacccgatcaacgtccttctgatcaaactgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgctgcagcgtggaatccgtccccgataaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgcaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatgtccctgctgctccaggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatgggggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctgtgttctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggt
gatagcgtagatgcgggtaaccatccggcggtggcactgcgtactgacggtgaccaggta
cagattaacaacgttaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccgcgtacgctggtgaccaacagctacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcacaactgggccgctcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacggctaaaccgtggggcgatgcggtgatctct
aatcgtccgtttgcgggtaacaccggcagcgttgacgatagcgacgaaatacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagcaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system