KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_1599Help
Entry
G2583_1599        CDS       T01190                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00260  Glycine, serine and threonine metabolism
eok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01130  Biosynthesis of antibiotics
eok01230  Biosynthesis of amino acids
Module
eok_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G2583_1599 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    G2583_1599 (trpA)
Enzymes [BR:eok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     G2583_1599 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADD56181
UniProt: D3QRM9
Structure
PDB: 

Jmol
Position
complement(1629517..1630323)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVPPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPKKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcgctgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcagat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgcccccggcgcag
tgctttgagatgctggcactcattcgccagaaacacccgaccattcccattggcctgctg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacatatttgctgtcacgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttctgcgattgttaaaatc
atcgagcaacatattaatgagccaaagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system