KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2169Help
Entry
G2583_2169        CDS       T01190                                 

Gene name
pfkB
Definition
6-phosphofructokinase II
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G2583_2169 (pfkB)
   01230 Biosynthesis of amino acids
    G2583_2169 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_2169 (pfkB)
   00030 Pentose phosphate pathway
    G2583_2169 (pfkB)
   00051 Fructose and mannose metabolism
    G2583_2169 (pfkB)
   00052 Galactose metabolism
    G2583_2169 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    G2583_2169 (pfkB)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     G2583_2169 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2199128..2200060
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggagcgctgggtgttgatagtgaaaactgcatt
caggtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgatagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgat
acgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system