KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2227Help
Entry
G2583_2227        CDS       T01190                                 

Gene name
yeaD
Definition
Aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eok00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2256389..2257294
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDAN
GVALTFELTQSEETKKFWLHDFTLLAHFRVDKNCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASEMQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtagtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgca
ggtgaagaagaagttctgtggttgagcaacaacacaccgttcaaaaatggcgttgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggcggcacaacaaggcctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcgtgaagatgctaat
ggcgtagcgctgacttttgaattgacacaaagcgaagagacgaaaaaattctggctgcac
gactttactctgttagcgcatttccgcgtggataaaaactgtgaaatcgatcttgaagca
cacggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtaaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaacccgggaccggcgctttcagttagcatgggc
gacatgccggacgatggctacaagacctttgtttgtgtagaaacagcttacgcctcagaa
atgcaaaaagtgaccaaagaaaaacctgcacatctggcgcaatccattcgcgttgccaaa
cgttaa

DBGET integrated database retrieval system