KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2370Help
Entry
G2583_2370        CDS       T01190                                 

Gene name
dcyD
Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    G2583_2370 (dcyD)
Enzymes [BR:eok01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     G2583_2370 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2390605..2391591)
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNAQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggctggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatctaggacgggaaattttcatcaaacgggat
gacgtcacccccatggcaatgggcggcaataaattacgtaagctagaatttctcgcggca
gatgctctgcgtgaaggtgccgatacgctgattactgccggggcgatccagtctaaccat
gtgcggcagactgccgcagtcgctgccaaactcggtctgcactgcgtggcgctgctggaa
aatcctattggcacaaccgcagaaaactatttaaccaacggcaatcgcttgttgctggat
ctgttcaatacccagattgaaatgtgcgacgcactgaccgatcccaatgcccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctcttggcgcgctaggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcatcggtggtagtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgaccgtg
tcgcgttccgttgccgatcaattgccgaaagtggttaacctacaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcgggtctgattgacggtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggcgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system