KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2564Help
Entry
G2583_2564        CDS       T01190                                 

Gene name
galF
Definition
UDP-glucose pyrophosphorylase GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    G2583_2564 (galF)
   00052 Galactose metabolism
    G2583_2564 (galF)
   00500 Starch and sucrose metabolism
    G2583_2564 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    G2583_2564 (galF)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     G2583_2564 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2568181..2569074)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFLKNIEQLLAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcagtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtacaatctatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggtgaacctttaggtttaggccactccattttatgtgcgcgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgttgcgttacaaccttgctgccatgattgcgcgcttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagaccaaa
gaaccgctggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacataatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcactcaacctggtgcatgggggcgtattcagctgactgat
gctattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgactggtgacagc
tacgactgtggtaaaaaaatgggctatatgcaggcgttcgtgaagtatgggctgcgcaac
ctaaaggaaggtgcgaaatttctcaagaatattgagcaattacttgctaaataa

DBGET integrated database retrieval system