KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2696Help
Entry
G2583_2696        CDS       T01190                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eok00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2718732..2719400)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL
METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgttagttgcgcgaggactg
gaaacaccgctgcgcccgcccgtgcatgaaatggataacgaaacgcgcaaaagccttatt
gctggtcatatgaccgaaatcatgcagctgctgaatctcgacctggctgatgacagtttg
atggaaacgccgcatcgcatcgctaaaatgtatgtcgatgaaattttctccggtctggat
tacgccaacttcccgaaaatcaccctcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcactctgaccagtacctgtgaacaccattttgttaccatcgatggc
aaagcgacggtggcttatatcccgaaagattcggtgatcggtctgtcaaaaattaaccgt
attgtgcagttctttgcccagcgtccgcaggtgcaggaacgtctgacgcagcaaattctc
attgcgctacaaacgctgctgggcaccaataacgtggctgtctctatcgacgcggtgcat
tattgcgtgaaggcgcgtggcatccgcgatgcaaccagtgccacgacaacgacctctctt
ggtggattgttcaaatccagtcagaatacgcgccacgagtttctgcgcgctgtgcgtcat
cacaactga

DBGET integrated database retrieval system