KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3391Help
Entry
G2583_3391        CDS       T01190                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3427368..3427994)
Genome map
AA seq 208 aa AA seqDB search
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagacgcgtacaagcacttctggatcaattacgtgcgcaaggtattcaggat
gagcaggtgctgaatgcacttgccgccgtgccgcgtgaaaaattcgttgatgaagcgttt
gaacaaaaagcctgggacaatatcgccttgccgataggtcaggggcagacgatttcgcag
ccgtatatggtggcgcgaatgaccgaattactcgagctgacgccgcagtcgcgggtgctg
gaaattggcaccggttcgggatatcaaacggcaatcctggcgcatcttgtccagcatgtt
tgctcggttgaacggattaaaggcttgcagtggcaggcgcgtcgccgcctgaaaaatctt
gatttacataatgtttcaacccgtcatggcgatggatggcaaggttggcaggcacgtgcg
ccgtttgacgctatcattgttacggcggcaccgccggaaattccaactgcgctaatgacg
cagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtatttgaaa
cgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgctttgtc
cctttagtgaagggtgagctggcttaa

DBGET integrated database retrieval system