KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3521Help
Entry
G2583_3521        CDS       T01190                                 

Gene name
xdhB
Definition
xanthine dehydrogenase FAD-binding subunit
Orthology
K13479  
xanthine dehydrogenase FAD-binding subunit [EC:1.17.1.4]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    G2583_3521 (xdhB)
Enzymes [BR:eok01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     G2583_3521 (xdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3564949..3565827
Genome map
AA seq 292 aa AA seqDB search
MFDFASYHRAATLADAINLLADNPQAKLLAGGTDVLIQLHHHNDRYRHIVDIHNLAELRG
ITLAEDGSLRIGSATTFTQLIEDSITQRHLPALCAAASSIAGPQIRNVATYGGNICNGAT
SADSATPTLIYDAKLEIHSPRGVRFVPINGFHTGPGKVSLEHDEILVAFHFPPQPKEHVG
SAHFKYAMRDAMDISTIGCAAHCRLDNGNFSELRLAFGVAAPTPIRCQHAEQTAQNAPLN
LQTLEAISESVLQDVAPRSSWRASKEFRLHLIQTMTKKVISEAVAAAGGKLQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttgcttcttaccatcgcgcagcaacccttgccgatgccatcaacctgctg
gctgacaacccgcaggccaaactgctcgccggtggcactgacgtactgattcagctccac
catcacaatgaccgttatcgccatattgttgatattcataatctggcggagctgcgggga
attacgctggcggaagatggctcgctacgtatcggctctgcaacgacatttacccagcta
atagaagattctataactcaacgtcatctcccggcgttatgtgctgcggcctcgtctatt
gctggaccgcagatccgtaacgtcgctacctacggtggaaatatttgcaacggtgccacc
agcgcagattctgccacgccaacgctcatttatgacgcgaaactggagatccactcccca
cgcggtgttcgtttcgtcccgattaatggctttcacaccgggccgggcaaagtgtctctt
gagcatgacgaaatccttgtcgcctttcattttccgccccagccgaaagaacacgtgggc
agcgcgcattttaaatatgccatgcgcgacgcaatggatatttcaacgattggctgtgcc
gcacattgccgactggataacggcaatttcagcgaattacgcctggcatttggtgttgcc
gcgccaacgccgattcgctgccaacatgccgaacagactgcacaaaatgcgccattaaac
ctgcaaacgctggaagctatcagcgaatctgtcctgcaagatgtcgccccgcgttcttca
tggcgggccagtaaagagtttcgtctgcatctcatccagacgatgaccaaaaaagtgatt
agcgaagccgtcgccgcggcggggggaaaattgcaatga

DBGET integrated database retrieval system