KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3846Help
Entry
G2583_3846        CDS       T01190                                 

Gene name
garK
Definition
hypothetical protein
Orthology
K00865  
glycerate kinase [EC:2.7.1.31]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    G2583_3846 (garK)
  Lipid metabolism
   00561 Glycerolipid metabolism
    G2583_3846 (garK)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G2583_3846 (garK)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     G2583_3846 (garK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3899502..3900728)
Genome map
AA seq 408 aa AA seqDB search
MAYCNPGLESRPNKRNALRRHVVTGIGMKIVIAPDSYKESLSASEVAQAIEKGFREIFPD
AQYVSVPVADGGEGTVEAMIAATQGSERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAA
SGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKL
CDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKG
ASEAMIVELDNNLSHYAEVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVT
TALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVV
HQHGIDAVFSVLTSIGTLDEAFRGAYDNICRASRNIAATLAIGMRNAG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattgcaatccgggcctggaatccaggccgaataagagaaacgccctccggcgt
catgtggtaacaggcataggtatgaaaatcgtaatcgccccagactcttataaagaaagt
ttatctgccagcgaggttgcgcaggcgatagaaaaaggatttcgggaaatttttcctgat
gcacagtacgtttctgttcctgttgccgacggtggcgaaggaacggtggaagcgatgatt
gcagccacccagggttccgaacgtcacgcctgggttacagggccgctgggcgagaaagtg
aatgccagttgggggatctccggcgatggcaaaaccgcgtttattgaaatggcggcggcc
agtgggctggagctggtacctgcggaaaaacgcgatccactcgtgaccacttcacgcggc
acaggcgagttaatcctgcaggcgctggagagcggcgcgacaaacattattatcggcatt
ggcggcagcgctacaaatgatggcggcgcaggcatggtacaggcgctgggggcgaaatta
tgcgacgccaacggcaatgaaattggttttggcggcggtagtcttaatactctgaatgat
attgatatttccggcctcgatccgcgcttaaaagattgcgtcattcgcgtcgcttgtgat
gtcaccaatccgctggtgggcgataacggcgcatcgcgcatctttggcccacaaaaggga
gccagtgaagcgatgattgttgagctggacaataacctctctcactatgccgaggtcatt
aaaaaagcgctgcatgttgatgtgaaagatgtccccggcgcaggagctgcgggtggtatg
ggcgcggcgctaatggcgtttcttggtgcggaactgaaaagtggtattgaaatcgtcact
acggcgctgaatctggaggaacatattcacgattgtacgctggtgatcaccggtgaaggg
cgtattgacagccagagtattcacggcaaggtaccgattggtgtcgcaaacgtggcgaag
aagtaccataaaccggtgattggcattgcgggtagcctgaccgatgatgttggcgttgta
catcagcatggcattgatgcggtcttcagcgtattgaccagcataggtacgttggacgaa
gcattccgcggggcttatgacaatatctgccgtgcttcacgtaatatcgccgcgacactg
gcgattggaatgcgcaacgcggggtga

DBGET integrated database retrieval system