KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3846Help
Entry
G2583_3846        CDS       T01190                                 

Gene name
garK
Definition
(GenBank) hypothetical protein
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00260  Glycine, serine and threonine metabolism
eok00561  Glycerolipid metabolism
eok00630  Glyoxylate and dicarboxylate metabolism
eok01100  Metabolic pathways
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    G2583_3846 (garK)
  Lipid metabolism
   00561 Glycerolipid metabolism
    G2583_3846 (garK)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G2583_3846 (garK)
Enzymes [BR:eok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     G2583_3846 (garK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-ProteinID: ADD58333
UniProt: D3QS66
Position
complement(3899502..3900728)
Genome map
AA seq 408 aa AA seqDB search
MAYCNPGLESRPNKRNALRRHVVTGIGMKIVIAPDSYKESLSASEVAQAIEKGFREIFPD
AQYVSVPVADGGEGTVEAMIAATQGSERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAA
SGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKL
CDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKG
ASEAMIVELDNNLSHYAEVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVT
TALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVV
HQHGIDAVFSVLTSIGTLDEAFRGAYDNICRASRNIAATLAIGMRNAG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattgcaatccgggcctggaatccaggccgaataagagaaacgccctccggcgt
catgtggtaacaggcataggtatgaaaatcgtaatcgccccagactcttataaagaaagt
ttatctgccagcgaggttgcgcaggcgatagaaaaaggatttcgggaaatttttcctgat
gcacagtacgtttctgttcctgttgccgacggtggcgaaggaacggtggaagcgatgatt
gcagccacccagggttccgaacgtcacgcctgggttacagggccgctgggcgagaaagtg
aatgccagttgggggatctccggcgatggcaaaaccgcgtttattgaaatggcggcggcc
agtgggctggagctggtacctgcggaaaaacgcgatccactcgtgaccacttcacgcggc
acaggcgagttaatcctgcaggcgctggagagcggcgcgacaaacattattatcggcatt
ggcggcagcgctacaaatgatggcggcgcaggcatggtacaggcgctgggggcgaaatta
tgcgacgccaacggcaatgaaattggttttggcggcggtagtcttaatactctgaatgat
attgatatttccggcctcgatccgcgcttaaaagattgcgtcattcgcgtcgcttgtgat
gtcaccaatccgctggtgggcgataacggcgcatcgcgcatctttggcccacaaaaggga
gccagtgaagcgatgattgttgagctggacaataacctctctcactatgccgaggtcatt
aaaaaagcgctgcatgttgatgtgaaagatgtccccggcgcaggagctgcgggtggtatg
ggcgcggcgctaatggcgtttcttggtgcggaactgaaaagtggtattgaaatcgtcact
acggcgctgaatctggaggaacatattcacgattgtacgctggtgatcaccggtgaaggg
cgtattgacagccagagtattcacggcaaggtaccgattggtgtcgcaaacgtggcgaag
aagtaccataaaccggtgattggcattgcgggtagcctgaccgatgatgttggcgttgta
catcagcatggcattgatgcggtcttcagcgtattgaccagcataggtacgttggacgaa
gcattccgcggggcttatgacaatatctgccgtgcttcacgtaatatcgccgcgacactg
gcgattggaatgcgcaacgcggggtga

DBGET integrated database retrieval system