KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3846Help
Entry
G2583_3846        CDS       T01190                                 

Gene name
garK
Definition
hypothetical protein
Orthology
K00865  
glycerate kinase [EC:2.7.1.31]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eok00630]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eok00561]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:eok00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3899502..3900728)
Genome map
AA seq 408 aa AA seqDB search
MAYCNPGLESRPNKRNALRRHVVTGIGMKIVIAPDSYKESLSASEVAQAIEKGFREIFPD
AQYVSVPVADGGEGTVEAMIAATQGSERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAA
SGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKL
CDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKG
ASEAMIVELDNNLSHYAEVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVT
TALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVV
HQHGIDAVFSVLTSIGTLDEAFRGAYDNICRASRNIAATLAIGMRNAG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattgcaatccgggcctggaatccaggccgaataagagaaacgccctccggcgt
catgtggtaacaggcataggtatgaaaatcgtaatcgccccagactcttataaagaaagt
ttatctgccagcgaggttgcgcaggcgatagaaaaaggatttcgggaaatttttcctgat
gcacagtacgtttctgttcctgttgccgacggtggcgaaggaacggtggaagcgatgatt
gcagccacccagggttccgaacgtcacgcctgggttacagggccgctgggcgagaaagtg
aatgccagttgggggatctccggcgatggcaaaaccgcgtttattgaaatggcggcggcc
agtgggctggagctggtacctgcggaaaaacgcgatccactcgtgaccacttcacgcggc
acaggcgagttaatcctgcaggcgctggagagcggcgcgacaaacattattatcggcatt
ggcggcagcgctacaaatgatggcggcgcaggcatggtacaggcgctgggggcgaaatta
tgcgacgccaacggcaatgaaattggttttggcggcggtagtcttaatactctgaatgat
attgatatttccggcctcgatccgcgcttaaaagattgcgtcattcgcgtcgcttgtgat
gtcaccaatccgctggtgggcgataacggcgcatcgcgcatctttggcccacaaaaggga
gccagtgaagcgatgattgttgagctggacaataacctctctcactatgccgaggtcatt
aaaaaagcgctgcatgttgatgtgaaagatgtccccggcgcaggagctgcgggtggtatg
ggcgcggcgctaatggcgtttcttggtgcggaactgaaaagtggtattgaaatcgtcact
acggcgctgaatctggaggaacatattcacgattgtacgctggtgatcaccggtgaaggg
cgtattgacagccagagtattcacggcaaggtaccgattggtgtcgcaaacgtggcgaag
aagtaccataaaccggtgattggcattgcgggtagcctgaccgatgatgttggcgttgta
catcagcatggcattgatgcggtcttcagcgtattgaccagcataggtacgttggacgaa
gcattccgcggggcttatgacaatatctgccgtgcttcacgtaatatcgccgcgacactg
gcgattggaatgcgcaacgcggggtga

DBGET integrated database retrieval system