KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4201Help
Entry
G2583_4201        CDS       T01190                                 

Gene name
nikE
Definition
(GenBank) Nickel import ATP-binding protein nikE
  KO
K10824  nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok02010  ABC transporters
Module
eok_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:eok00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    G2583_4201 (nikE)
Enzymes [BR:eok01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.24  nickel-transporting ATPase
     G2583_4201 (nikE)
Transporters [BR:eok02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    G2583_4201 (nikE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 SMC_N RsgA_GTPase AAA_16 Sigma54_activat PRK AAA_25 IstB_IS21 AAA_29 MMR_HSR1 AAA AAA_28 G-alpha NB-ARC AAA_18 NACHT SbcCD_C AAA_5 DUF87 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ADD58672
UniProt: D3QUA3
Position
4240972..4241778
Genome map
AA seq 268 aa AA seqDB search
MTLLNVSDLSHHYAHGGFSGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVG
LESPSQGNISWRGESLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLHAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQAVGEKL
TFSSDAGRVLQNAILPAFPVRRRATEKV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaacgtctccgacctttcccatcactatgcccacggtgggtttagcgga
aaacatcagcaccaggcggtgctgaataacgtttccctgaccctgaaaagcggtgaaacc
gtcgccctgctgggacgcagcggctgcggaaaaagcactctcgcgcggctactggtaggc
ttagaatcgccctcacagggaaatattagctggcgtggcgaatcgttggcaaagctcaat
cgcgcccagcgtaaagcgttccgccgcgatattcagatggtatttcaggactccatcagc
gccgtgaatccgcgcaaaaccgtgcgcgagatcctgcgggaaccgatgcgccacctgcta
tcgctgaaaaaatccgaacaactggcgcgtgccagcgaaatgctgcacgcggtcgatctc
gacgacagcgtgctcgacaagcgcccaccgcagttaagcggcggccagctccagcgcgtc
tgcctggcacgcgcgctggcggtcgaaccgaaattgctgattctggatgaagccgtttct
aaccttgatctcgtgttacaggcgggcgtcattcgcctgctgaaaaagctacaacaacag
tttggcactgcctgcctgttcatcactcatgacttacgcctggtggaacgcttttgccag
cgagtgatggtgatggacaacggacaaatcgtcgaaacccaggcggtgggagagaaatta
accttttcctctgacgccggacgtgtgctacaaaacgcgatattacccgcattccccgtg
cgccgtcgcgccacagaaaaggtttaa

DBGET integrated database retrieval system