KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4201Help
Entry
G2583_4201        CDS       T01190                                 

Gene name
nikE
Definition
nickel import ATP-binding protein nikE
Orthology
K10824  
nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
ABC transporters
Module
Nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:eok02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4240972..4241778
Genome map
AA seq 268 aa AA seqDB search
MTLLNVSDLSHHYAHGGFSGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVG
LESPSQGNISWRGESLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLHAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQAVGEKL
TFSSDAGRVLQNAILPAFPVRRRATEKV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaacgtctccgacctttcccatcactatgcccacggtgggtttagcgga
aaacatcagcaccaggcggtgctgaataacgtttccctgaccctgaaaagcggtgaaacc
gtcgccctgctgggacgcagcggctgcggaaaaagcactctcgcgcggctactggtaggc
ttagaatcgccctcacagggaaatattagctggcgtggcgaatcgttggcaaagctcaat
cgcgcccagcgtaaagcgttccgccgcgatattcagatggtatttcaggactccatcagc
gccgtgaatccgcgcaaaaccgtgcgcgagatcctgcgggaaccgatgcgccacctgcta
tcgctgaaaaaatccgaacaactggcgcgtgccagcgaaatgctgcacgcggtcgatctc
gacgacagcgtgctcgacaagcgcccaccgcagttaagcggcggccagctccagcgcgtc
tgcctggcacgcgcgctggcggtcgaaccgaaattgctgattctggatgaagccgtttct
aaccttgatctcgtgttacaggcgggcgtcattcgcctgctgaaaaagctacaacaacag
tttggcactgcctgcctgttcatcactcatgacttacgcctggtggaacgcttttgccag
cgagtgatggtgatggacaacggacaaatcgtcgaaacccaggcggtgggagagaaatta
accttttcctctgacgccggacgtgtgctacaaaacgcgatattacccgcattccccgtg
cgccgtcgcgccacagaaaaggtttaa

DBGET integrated database retrieval system