KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4832Help
Entry
G2583_4832        CDS       T01190                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G2583_4832 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    G2583_4832 (aceA)
Enzymes [BR:eok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     G2583_4832 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4913132..4914451
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPAN
SVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDA
DAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFAEAIHAKYPGKLLAYNCSPSFNWQKNLDDNTIASFQQQLSDMGYKFQFITLAGI
HSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacacaacaaattgaagaattacagaaagagtgg
actcaaccgcgttgggaaggaattactcgcccatacagcgcggaagatgtggtgaaatta
cgcggttcagtcaatcctgaatgcacgctggcgcaactgggcgcggcgaaaatgtggcgt
ctgctgcatggcgagtcgaaaaaaggctacatcaacagcctcggtgcactgactggcggt
caggcgctgcaacaggcgaaagcgggtattgaagcggtctatctgtcgggatggcaggta
gcggcggacgctaacctggcggccagcatgtatccggatcagtcgctctatccggcaaac
tcggtgccagctgtggtggagcggatcaacaacactttccgccgtgcggatcagatccaa
tggtccgcgggcattgagccgggcgatccgcgctatgtcgattacttcctgccgatcgtt
gccgacgcggaagccggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctggcgtcagtgaagaaatgc
ggtcacatgggcggcaaagttttggtgccaactcaggaagctattcagaaactggtcgcg
gcgcgtctggcagctgacgtgacgggcgttccaaccctgctggttgcacgtaccgatgct
gatgcggcggatctgatcacctccgattgcgacccgtatgacagcgaatttattaccggc
gagcgtaccagtgaaggcttcttccgtactcatgcgggcattgagcaagcgatcagccgt
ggcctggcgtatgcgccatatgctgacctggtatggtgtgaaacctccacgccggatctg
gaactggcgcgtcgctttgcggaagctatccacgcgaaatatccgggcaaactgctggct
tataactgctcgccgtcgttcaactggcagaaaaacctcgacgacaacactattgccagc
ttccagcagcagctgtcggatatgggctacaagttccagttcatcaccctggcaggtatc
cacagcatgtggttcaacatgtttgatctggcaaacgcctatgcccagggcgagggtatg
aagcactatgttgagaaagtgcagcagccggaattcgccgccgcgaaagatggctacacc
ttcgtatctcaccagcaggaagtgggtacaggttacttcgataaagtgacgaccattatt
cagggcggcacgtcgtcggttaccgcgctgactggctccaccgaagaatcgcagttctaa

DBGET integrated database retrieval system