KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4894Help
Entry
G2583_4894        CDS       T01190                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00010  Glycolysis / Gluconeogenesis
eok00620  Pyruvate metabolism
eok00640  Propanoate metabolism
eok00680  Methane metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_4894 (acs)
   00620 Pyruvate metabolism
    G2583_4894 (acs)
   00640 Propanoate metabolism
    G2583_4894 (acs)
  Energy metabolism
   00680 Methane metabolism
    G2583_4894 (acs)
Enzymes [BR:eok01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     G2583_4894 (acs)
Lipid biosynthesis proteins [BR:eok01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   G2583_4894 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADD59320
UniProt: D3QK76
Position
complement(4987438..4989396)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWIKPYQKVKNISF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLKLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDQ
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDSYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcacctgataccttctggggc
gaacagggaaaaattctcgactggatcaaaccgtaccagaaggtgaaaaacatctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcaagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgtattggcgcggtgcattcg
gtaattttcggtggcttctcgccggaagcggttgccgggcgcattatcgattccaactca
cgactggtgatcacttccgacgaaggcgtgcgcgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcactaaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgaccag
gttgagcaagccagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggaaaaccaaaaggcgtactgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttatttgctgtacggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcacaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaaccggcggt
ttcatgatcaccccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggggctacc
gaaggtagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctatttttccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgtgatgaagatagctattactggatcaccgggcgtgtggacgatgtgctg
aacgtctccggtcaccgtctgggaacggcggagattgagtcggcgctggtggcgcatccg
aaaatcgccgaagccgctgtcgtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system