KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_5044Help
Entry
G2583_5044        CDS       T01190                                 

Gene name
cysQ
Definition
PAPS (adenosine 3-phosphate 5-phosphosulfate) 3(2),5-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eok00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5140628..5141368
Genome map
AA seq 246 aa AA seqDB search
MLDQVCQLARNAGDAIMQVYDGAKPMDIVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagtatgccagcttgcacggaatgcaggcgatgccattatgcaggtctac
gacggggcgaaaccgatggacatcgtcagcaaagcggacaattctccggtaacggcagcg
gatattgccgctcacaccgttatcatggacggtttacgtacgctgacaccggatattccg
gtcctttctgaagaagatcctcccggttgggaagtccgtcagcactggcagcgttactgg
ctggtagacccgctggatggtacgaaagagtttattaaacgtaatggcgaattcaccgtt
aacattgcgctcattgaccatggcaaaccgattttaggtgtggtgtatgcgccggtaatg
aacgtaatgtacagcgcggcagaaggcaaggcctggaaagaagagtgcggcgtgcgcaag
cagattcaggtccgcgatgcgcgcccgccgctggtggtgatcagccgctctcatgcggat
gcggagctgaaagagtatctgcaacagcttggcgaacatcagaccacgtccatcggctct
tcgctgaagttctgcctggtggcggaaggacaggcgcagctgtacccgcgtttcggacca
acgaatatttgggacaccgccgctggacatgctgtggctgcagctgccggagcgcatgtt
cacgactggcagggtaaaccgctggattacactccgcgcgagtcgttcctgaatccgggg
ttcagagtgtctatttactaa

DBGET integrated database retrieval system