KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_5201Help
Entry
G2583_5201        CDS       T01190                                 

Gene name
ydfQ
Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Brite
Enzymes [BR:eok01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     G2583_5201 (ydfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5325777..5326310
Genome map
AA seq 177 aa AA seqDB search
MNAKIKYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLTKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGMASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDRGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcaaatacggcctgtcagcggccgttctggcgctgattggagcaggc
gcatctgctcctgagatacttgaccagtttctggatgaaaaagagggtaaccacactacg
gcataccgcgatggttccggcatatggaccatctgtcgaggggccacgatggtggatggt
aaacctgttattcctggcatgaaactgacgaaggaaaaatgcgatcaggttaatgccatt
gaacgggataaggcgctggcatgggtggagcgcaatattaaagtgccattgaccgaacca
cagaaagcgggtatggcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgcaggtgatcgtaaaggtgcctgcgaggcgattcgc
tggtggattaaggacagggggcgcgattgccgcattcgatcaaataactgttacggtcag
gttattcgtcgtgaccaggagagtgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system