KEGG   Emticicia oligotrophica: Emtol_0604Help
Entry
Emtol_0604        CDS       T02272                                 

Definition
Carbohydrate kinase, FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eol  Emticicia oligotrophica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Emtol_0604
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Emtol_0604
Exosome [BR:eol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Emtol_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294159..295664
Genome map
AA seq 501 aa AA seqDB search
MKKYILSIDQGTSSTKTIIFDESGNAVAKGHADLQTNYFDNGFVEQAPEGIYQNVLESIF
LCIQDFLSKGFSIENIISVGISNQRETFILWDKAGKPLTPAVVWACKRSIEICQKLKGKN
QEPFIKERTGLIIDPYFSATKLLWLLENDADLKMKLDNGEVFFGTVDCWLLWKMTNGQSF
KTDFTNAHRTLLFNIHTLTWDKEILQLWGLEKLNLPEVCASSSDFGFWVLDLSNLDSIHF
PKSKIPIQAMIGDSHAATFGEGCFEQGTAKVTMGTGSSIMMNIGDKPVLSNNGMLTTICW
STENRIDFAFEGAIVACGSTIEWVKNELGFFKEVAETEAMALSVSDNAGVYLIPAFSGLG
APHWQMNRRASIEGMTFGTSKNHIVRAALESIPYQIKDVINAMQNDMDSKLKSISVNGGL
TRNQFVIRFLVDLLGLPLKKQQNPDVSALGAAYLAGLKSGIYESISQLKMLNQAKTEEIL
PDLGNHLVKKGYEGWIQKIQN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacatcctctccatagaccaaggcacaagtagcaccaaaacaatcattttt
gatgaaagtggaaatgcagtagccaaaggtcatgccgatttacagactaattattttgac
aatggctttgtggagcaagcccccgaaggcatttatcaaaatgtattggagtcgattttt
ctttgtattcaagattttctgtcaaaaggattttcaattgaaaatattatttctgttgga
atcagtaatcaacgagaaacatttattctttgggataaagcaggtaaaccacttacacca
gcagtggtatgggcttgtaaacgttcgatagaaatttgccaaaaactaaaaggtaaaaac
caagaaccattcattaaagaaagaacaggcttaataattgatccttatttttcagctaca
aaactgctttggctgctcgaaaacgatgcagatttaaagatgaaattagataatggtgaa
gtatttttcggtacagtcgattgctggcttttgtggaaaatgactaacggtcaatctttc
aaaactgattttaccaacgctcaccgaacacttcttttcaatattcacacccttacttgg
gataaagaaattctccaactttggggattggaaaaacttaatttaccagaagtatgtgct
tcgagttcggattttggattttgggttttggatttatccaacctagattcaatccacttt
ccgaaatccaaaatcccaattcaagcaatgatcggtgattctcacgctgctacttttggt
gaagggtgcttcgagcaaggaacagcgaaagttacgatgggaacgggtagctcaatcatg
atgaatattggagataaaccagttttatcaaataatggcatgttgacgaccatttgttgg
agcacagaaaataggattgattttgcatttgaaggagcaattgtagcatgtggctctacc
atagaatgggtgaaaaatgaattaggattcttcaaagaagtagccgaaaccgaagcaatg
gcactttcggtcagtgataatgctggcgtttatctcattcctgcttttagtggtttaggt
gctcctcattggcaaatgaatcgccgtgcttccattgaggggatgacctttggtacaagc
aaaaatcatattgttcgagcagctttagaaagcattccctatcaaataaaggatgtaata
aatgccatgcaaaacgacatggattcgaagctaaaatccatttcagtcaatggcggacta
actcgtaatcaattcgttatcaggtttttagtcgatttattaggtttacctctcaaaaaa
caacaaaatcctgatgtttctgctttgggagcagcttatttagcaggtttaaaaagtggt
atttacgaaagtatcagccaactgaaaatgctaaatcaagcaaaaaccgaagaaatttta
ccagatttaggcaatcatttagtcaaaaaaggctatgaaggttggatacagaaaattcaa
aattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system