KEGG   Emticicia oligotrophica: Emtol_0604Help
Entry
Emtol_0604        CDS       T02272                                 

Definition
Carbohydrate kinase, FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eol  Emticicia oligotrophica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eol00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294159..295664
Genome map
AA seq 501 aa AA seqDB search
MKKYILSIDQGTSSTKTIIFDESGNAVAKGHADLQTNYFDNGFVEQAPEGIYQNVLESIF
LCIQDFLSKGFSIENIISVGISNQRETFILWDKAGKPLTPAVVWACKRSIEICQKLKGKN
QEPFIKERTGLIIDPYFSATKLLWLLENDADLKMKLDNGEVFFGTVDCWLLWKMTNGQSF
KTDFTNAHRTLLFNIHTLTWDKEILQLWGLEKLNLPEVCASSSDFGFWVLDLSNLDSIHF
PKSKIPIQAMIGDSHAATFGEGCFEQGTAKVTMGTGSSIMMNIGDKPVLSNNGMLTTICW
STENRIDFAFEGAIVACGSTIEWVKNELGFFKEVAETEAMALSVSDNAGVYLIPAFSGLG
APHWQMNRRASIEGMTFGTSKNHIVRAALESIPYQIKDVINAMQNDMDSKLKSISVNGGL
TRNQFVIRFLVDLLGLPLKKQQNPDVSALGAAYLAGLKSGIYESISQLKMLNQAKTEEIL
PDLGNHLVKKGYEGWIQKIQN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacatcctctccatagaccaaggcacaagtagcaccaaaacaatcattttt
gatgaaagtggaaatgcagtagccaaaggtcatgccgatttacagactaattattttgac
aatggctttgtggagcaagcccccgaaggcatttatcaaaatgtattggagtcgattttt
ctttgtattcaagattttctgtcaaaaggattttcaattgaaaatattatttctgttgga
atcagtaatcaacgagaaacatttattctttgggataaagcaggtaaaccacttacacca
gcagtggtatgggcttgtaaacgttcgatagaaatttgccaaaaactaaaaggtaaaaac
caagaaccattcattaaagaaagaacaggcttaataattgatccttatttttcagctaca
aaactgctttggctgctcgaaaacgatgcagatttaaagatgaaattagataatggtgaa
gtatttttcggtacagtcgattgctggcttttgtggaaaatgactaacggtcaatctttc
aaaactgattttaccaacgctcaccgaacacttcttttcaatattcacacccttacttgg
gataaagaaattctccaactttggggattggaaaaacttaatttaccagaagtatgtgct
tcgagttcggattttggattttgggttttggatttatccaacctagattcaatccacttt
ccgaaatccaaaatcccaattcaagcaatgatcggtgattctcacgctgctacttttggt
gaagggtgcttcgagcaaggaacagcgaaagttacgatgggaacgggtagctcaatcatg
atgaatattggagataaaccagttttatcaaataatggcatgttgacgaccatttgttgg
agcacagaaaataggattgattttgcatttgaaggagcaattgtagcatgtggctctacc
atagaatgggtgaaaaatgaattaggattcttcaaagaagtagccgaaaccgaagcaatg
gcactttcggtcagtgataatgctggcgtttatctcattcctgcttttagtggtttaggt
gctcctcattggcaaatgaatcgccgtgcttccattgaggggatgacctttggtacaagc
aaaaatcatattgttcgagcagctttagaaagcattccctatcaaataaaggatgtaata
aatgccatgcaaaacgacatggattcgaagctaaaatccatttcagtcaatggcggacta
actcgtaatcaattcgttatcaggtttttagtcgatttattaggtttacctctcaaaaaa
caacaaaatcctgatgtttctgctttgggagcagcttatttagcaggtttaaaaagtggt
atttacgaaagtatcagccaactgaaaatgctaaatcaagcaaaaaccgaagaaatttta
ccagatttaggcaatcatttagtcaaaaaaggctatgaaggttggatacagaaaattcaa
aattaa

DBGET integrated database retrieval system