KEGG   Emticicia oligotrophica: Emtol_0635Help
Entry
Emtol_0635        CDS       T02272                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eol  Emticicia oligotrophica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_0635
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Emtol_0635
   00630 Glyoxylate and dicarboxylate metabolism
    Emtol_0635
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Emtol_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324091..325692)
Genome map
AA seq 533 aa AA seqDB search
MRTNTDTSVDILGEVKPAYETILTPEAIDFIIGLHKRFNWRREDLLTQRQERQHRIDAGE
MPNFLESTKQIRESEWQINPIPQDLQNRRVEITGPVDRRMIINALNSGAKVFMADFEDAN
SPTWDNCIEGQLNLRAAIRREIDFIAENGRTYSLNEKTAVLKVRPRGWHLLEKHLEVEGE
PISASIFDFGLYFFHNAKQLIENGSGPYFYLPKLESHLEARLWDDIFVAAQETLGIPIGT
IKVTVLIETILAAFEMDEIIYELRRHLAGLNAGRWDYIFSVIKKFRNHAEFILPDRADVT
MRVPFMRAYTQLLVKTCHRRGAHAIGGMAAFIPNRRDEKVNTLAFERVTADKELEVNNGF
DGTWVAHPDLVPVAMEAFNKKLGEKSHQKEILREDVRVTADDLLDVRIDNATITENGLRT
NINVGILYIDSWLRGIGAAAIHNLMEDAATAEISRAQIWQWLKHRVKTQEGDIIEPNYYH
QLLVEEVEKIKKLAENGQIPEGKYKKAAELFNTLVMKRQFSEFLTLGAYKELE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaataccgacacctcagtagatatcttaggcgaagtaaaaccagcctatgag
acaatcttaactcctgaagccattgattttattattgggctacacaaaaggttcaattgg
agaagagaagatttattgacacaacgccaagagcgtcagcatagaatcgatgctggtgaa
atgcctaactttttagagtctactaaacagataagagaatcggagtggcaaataaatcct
attccacaagatttgcaaaatcgacgagttgagattactggccccgttgaccgacgaatg
ataatcaatgctctcaattcaggagcaaaagttttcatggctgatttcgaggatgctaat
tctcctacttgggataattgtatagaaggccagttgaatttacgagcagccattcgtcgt
gagatagattttatagcagaaaatggtagaacttattctttgaatgaaaaaacggctgtg
ttgaaagtaagaccaagaggatggcatttgttagaaaagcatttagaagttgagggagaa
ccaatttcagcgtcaatttttgactttggcttgtatttttttcataatgcaaaacagctt
attgaaaatggcagtggtccatatttttacttacctaaacttgaaagtcatttagaagca
cgtttatgggatgatattttcgtagcagcccaagaaactttgggtattccaattggaaca
atcaaggttacggttttgatagaaacgattttggctgcttttgagatggatgagataatc
tacgagcttcgccgtcatttagctggtctaaacgctggtcgatgggattatatctttagt
gtaatcaaaaaatttagaaatcatgcagaatttatcttgcctgatcgtgcagatgtaacg
atgcgagtaccttttatgcgtgcctatactcaattattggttaaaacttgtcatcgaaga
ggggcacatgctattggaggaatggctgcatttattccgaatcggagagatgaaaaagtt
aatactttggcttttgagagagtaactgccgataaagaactcgaagtaaataatggattt
gatggaacttgggtagctcacccagatttggtgccagtggctatggaagcattcaataag
aaattaggggaaaagtctcaccaaaaagaaattttgagggaggatgtaagggtaactgca
gacgatttattggatgtaagaattgataatgccacaataacagaaaacggtcttcgaacg
aatatcaatgtaggaattctttacatagattcttggttacgaggcattggtgctgctgcc
atacataatttaatggaagatgctgcaactgccgaaatctcaagagcacaaatttggcaa
tggctgaaacatcgggtgaagactcaagaaggagatattattgaacctaattattaccat
caactactggttgaagaagtggaaaagattaaaaaattggcagaaaatggtcaaattcca
gaggggaaatataaaaaagcagcagagttattcaatacattagttatgaaacgccaattc
agcgaatttctgactttaggtgcatataaagaacttgaataa

DBGET integrated database retrieval system