KEGG   Emticicia oligotrophica: Emtol_0635Help
Entry
Emtol_0635        CDS       T02272                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eol  Emticicia oligotrophica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_0635
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Emtol_0635
   00630 Glyoxylate and dicarboxylate metabolism
    Emtol_0635
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Emtol_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324091..325692)
Genome map
AA seq 533 aa AA seqDB search
MRTNTDTSVDILGEVKPAYETILTPEAIDFIIGLHKRFNWRREDLLTQRQERQHRIDAGE
MPNFLESTKQIRESEWQINPIPQDLQNRRVEITGPVDRRMIINALNSGAKVFMADFEDAN
SPTWDNCIEGQLNLRAAIRREIDFIAENGRTYSLNEKTAVLKVRPRGWHLLEKHLEVEGE
PISASIFDFGLYFFHNAKQLIENGSGPYFYLPKLESHLEARLWDDIFVAAQETLGIPIGT
IKVTVLIETILAAFEMDEIIYELRRHLAGLNAGRWDYIFSVIKKFRNHAEFILPDRADVT
MRVPFMRAYTQLLVKTCHRRGAHAIGGMAAFIPNRRDEKVNTLAFERVTADKELEVNNGF
DGTWVAHPDLVPVAMEAFNKKLGEKSHQKEILREDVRVTADDLLDVRIDNATITENGLRT
NINVGILYIDSWLRGIGAAAIHNLMEDAATAEISRAQIWQWLKHRVKTQEGDIIEPNYYH
QLLVEEVEKIKKLAENGQIPEGKYKKAAELFNTLVMKRQFSEFLTLGAYKELE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaataccgacacctcagtagatatcttaggcgaagtaaaaccagcctatgag
acaatcttaactcctgaagccattgattttattattgggctacacaaaaggttcaattgg
agaagagaagatttattgacacaacgccaagagcgtcagcatagaatcgatgctggtgaa
atgcctaactttttagagtctactaaacagataagagaatcggagtggcaaataaatcct
attccacaagatttgcaaaatcgacgagttgagattactggccccgttgaccgacgaatg
ataatcaatgctctcaattcaggagcaaaagttttcatggctgatttcgaggatgctaat
tctcctacttgggataattgtatagaaggccagttgaatttacgagcagccattcgtcgt
gagatagattttatagcagaaaatggtagaacttattctttgaatgaaaaaacggctgtg
ttgaaagtaagaccaagaggatggcatttgttagaaaagcatttagaagttgagggagaa
ccaatttcagcgtcaatttttgactttggcttgtatttttttcataatgcaaaacagctt
attgaaaatggcagtggtccatatttttacttacctaaacttgaaagtcatttagaagca
cgtttatgggatgatattttcgtagcagcccaagaaactttgggtattccaattggaaca
atcaaggttacggttttgatagaaacgattttggctgcttttgagatggatgagataatc
tacgagcttcgccgtcatttagctggtctaaacgctggtcgatgggattatatctttagt
gtaatcaaaaaatttagaaatcatgcagaatttatcttgcctgatcgtgcagatgtaacg
atgcgagtaccttttatgcgtgcctatactcaattattggttaaaacttgtcatcgaaga
ggggcacatgctattggaggaatggctgcatttattccgaatcggagagatgaaaaagtt
aatactttggcttttgagagagtaactgccgataaagaactcgaagtaaataatggattt
gatggaacttgggtagctcacccagatttggtgccagtggctatggaagcattcaataag
aaattaggggaaaagtctcaccaaaaagaaattttgagggaggatgtaagggtaactgca
gacgatttattggatgtaagaattgataatgccacaataacagaaaacggtcttcgaacg
aatatcaatgtaggaattctttacatagattcttggttacgaggcattggtgctgctgcc
atacataatttaatggaagatgctgcaactgccgaaatctcaagagcacaaatttggcaa
tggctgaaacatcgggtgaagactcaagaaggagatattattgaacctaattattaccat
caactactggttgaagaagtggaaaagattaaaaaattggcagaaaatggtcaaattcca
gaggggaaatataaaaaagcagcagagttattcaatacattagttatgaaacgccaattc
agcgaatttctgactttaggtgcatataaagaacttgaataa

DBGET integrated database retrieval system