KEGG   Emticicia oligotrophica: Emtol_0689Help
Entry
Emtol_0689        CDS       T02272                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
eol  Emticicia oligotrophica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(392460..393503)
Genome map
AA seq 347 aa AA seqDB search
MKFKNLSMLVSSVVYLGVACNSDNSQDISPEQLFTKPANFPAPVYNFDKNPMSVAGFELG
KELFNDGDLSRDGSIACADCHNQAYAFTHHGHDVSHGIDNLKGVRNAPPIQNMAFQKEFF
WDGGVFDLDLFSIAPIENPLEMDEKLGNVLEKLRKKEKYATLFQKAYGSKEITTERFLKA
LSQFMNALVSANSRYDKYVRKEQGGILTEDELAGLEVFKQKCASCHSGELFTDQSYRNNG
LPVYNLDDTGRGRITQNRKDEYTFKVPSLRNIEVSAPYMHDGRFYSLEAVLNHYNDGIVD
SPTLDTSLKNGSKLGIQTTADEQKKLIAFLKTLTDNDFLKNKRFGIQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaagaatttatctatgttggttagtagcgttgtttatttgggagttgcgtgt
aacagcgataactcccaagatattagcccagaacaactttttactaaacctgccaatttt
cctgcaccggtttataatttcgataaaaatccaatgtcggttgctggatttgaacttggg
aaagagctctttaatgatggtgatttatcgagagatggctcaattgcttgtgctgattgt
cataatcaagcctatgcctttacacatcatgggcatgatgtaagtcatggaattgataat
ttgaaaggtgtcagaaatgctccgccgatacagaatatggcatttcaaaaagagtttttt
tgggatggcggtgtttttgatttggatttattttctatcgcacccattgaaaatccatta
gaaatggatgaaaaattaggcaatgttttagaaaagctacgaaaaaaagaaaagtatgct
acgctttttcagaaagcttatggaagtaaggagattacaactgaacgttttttgaaagct
ctttcacaatttatgaatgctttggtttcggccaattcacgctacgataaatatgtaaga
aaagagcaaggaggaattttaactgaggatgaattggcaggattggaggtttttaagcaa
aaatgtgcatcatgtcattcgggtgaattatttaccgaccaaagttatcgaaataacggt
ttgcctgtttataatttagatgatacgggtcgaggtagaattacacaaaaccgcaaggac
gaatatacgtttaaagtaccaagtttacgaaatattgaggtttcggccccttatatgcac
gatggacgtttttattcacttgaggctgtgttaaatcattataacgatggaattgttgat
tctccaacattagatacttcgttgaaaaatggctcaaaattagggattcaaacaacggct
gatgaacaaaagaagttaatcgcttttttgaaaacattaacagataatgattttctgaaa
aataaacgatttggtattcaatag

DBGET integrated database retrieval system