KEGG   Emticicia oligotrophica: Emtol_0742Help
Entry
Emtol_0742        CDS       T02272                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eol  Emticicia oligotrophica
Pathway
eol00071  Fatty acid degradation
eol00280  Valine, leucine and isoleucine degradation
eol00281  Geraniol degradation
eol00310  Lysine degradation
eol00362  Benzoate degradation
eol00380  Tryptophan metabolism
eol00410  beta-Alanine metabolism
eol00640  Propanoate metabolism
eol00650  Butanoate metabolism
eol00903  Limonene and pinene degradation
eol00930  Caprolactam degradation
eol01040  Biosynthesis of unsaturated fatty acids
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
eol01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Emtol_0742
   00650 Butanoate metabolism
    Emtol_0742
  Lipid metabolism
   00071 Fatty acid degradation
    Emtol_0742
   01040 Biosynthesis of unsaturated fatty acids
    Emtol_0742
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Emtol_0742
   00310 Lysine degradation
    Emtol_0742
   00380 Tryptophan metabolism
    Emtol_0742
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Emtol_0742
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Emtol_0742
   00281 Geraniol degradation
    Emtol_0742
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Emtol_0742
   00930 Caprolactam degradation
    Emtol_0742
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Emtol_0742
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Emtol_0742
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Emtol_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFK01894
UniProt: I2EQE1
Position
complement(467401..469545)
Genome map
AA seq 714 aa AA seqDB search
MEINYKVENNVAIISWNMTTSPMNVMNDISIPEFAGHLETAYADPEVKGIIITSEKNEFI
AGADVKMILRNNDKDQSEMHKFSLDFNGIFRKLETCGKPVVAAMNGTALGGGYEVCLACH
YRVALDNPKAVIGLPEVQLGLLPGGGGTQRLPRLIGMEAALMLMVEGKRITPKEAMGYGM
INDLAATREEMMEKAMKWILANPKAIQPWDEFDKKTGAIKARENYKVPGGNVQSPTGMRT
FAGGTAMIMDRTKGNYPAPIAILSCVYEGLQVNIDRAIPIEARYFVKVATSPEAKNLIGV
MFLGKNEADKGASRPKNIPATDVKKIGILGAGFMGAGIAYVSAMAGIEVVLKDISLENAE
KGKDYSRGLVQKGVERGKTTAEKGEKLLSLIKPTADVTDLKGCDLIIEAVFENRELKATV
TKEAEPMLAEGGVFGSNTSTIPITGLANASAKPENFIGIHFFSPVDKMMLVELIRGKQTS
DYAVALAVDFVKKIRKTPIVVNDSRGFYTSRCFSTYTTEGIALLKDGVDPVMIENAGKNA
GMPVGPLAVSDEVALDLALKISKQSIADGALSETDAAYQVTRMMVEDLGRFGKKNKKGFY
EYPESGKKYLWEGLAEHFPISKIQPEVEEVKKRLLYRQVVESIRCMDEGVLITKLDGNIG
SILAWGFPPYAGGTLNFPEFVGKETFLKEVERLADTYGERFRLSSKQKELVMNL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaactataaagtagaaaataacgtggcgattatcagttggaatatgacaact
tcgccaatgaacgtgatgaatgatatttcgattccagaatttgcagggcatcttgagact
gcttacgctgaccctgaagtaaaaggaatcatcattacttccgaaaaaaatgagtttatt
gctggggcagatgtgaagatgattttgcggaataatgataaagaccagagcgaaatgcac
aagttttccttagattttaatggtatttttcgaaaactagaaacttgtggaaaaccagtt
gttgctgcaatgaatggtacagctttaggtggtggttacgaggtatgtctggcttgtcat
tatcgagtggcacttgataaccctaaagccgtgataggtttaccagaagtacaattaggc
ttgttacccggcggtggtggaacccagcgtttacctcgtttgattggcatggaagcagct
ctgatgttgatggttgaaggaaaacgaattacgcctaaagaagccatgggctacggaatg
ataaacgaccttgcggccactcgtgaagaaatgatggaaaaagccatgaaatggattctg
gcaaaccctaaagctattcaaccgtgggatgagtttgataaaaaaacgggtgccattaaa
gctcgtgaaaattataaagttccgggaggaaatgtgcaatcgcctactggaatgcgtaca
tttgctggtggtacggccatgattatggatagaaccaaaggtaattatccagcaccaatt
gctattctttcttgtgtatatgaaggtttacaagtaaatatcgaccgtgcaattccaatt
gaggctcgttattttgtgaaagtggctacctcaccagaagcaaaaaacctaattggtgta
atgtttttgggcaaaaatgaagctgataagggtgcaagcagacctaaaaatatacccgca
accgatgttaagaaaataggtattttaggagcaggttttatgggagcagggattgcctat
gtttcagcaatggctggaattgaggtagttttgaaagatattagtcttgaaaatgctgaa
aaaggcaaggattattcaaggggtttagtacaaaaaggagtagagcgtggaaaaacaacg
gcagaaaaaggtgaaaaattgttgagtctaatcaagccaacggccgatgttacagattta
aaaggatgcgatttaattattgaggcggtatttgaaaaccgcgaattgaaagcgactgtt
actaaagaagctgaaccaatgctagctgaaggtggagtttttggctcaaatacttcaact
attccgattacaggcttggctaatgcttcggcaaaacctgagaattttatcggaatccat
ttcttctcgccggttgataaaatgatgttagttgagttgattcgtgggaaacaaacttcc
gattacgctgttgctttggcagtagattttgtaaagaaaatacgcaaaacgccgattgtt
gttaatgattctcgcggattttatacttctcgttgcttttcaacttatacaacagaggga
attgctttattaaaagatggtgttgacccagttatgattgaaaatgcaggtaaaaatgct
gggatgccagtggggccattggcggtttctgatgaagtagctttagatttagctttaaaa
atttcgaagcaatcaattgcagatggggctttaagtgaaacagatgcggcttatcaggtt
accagaatgatggttgaagatttaggtagatttggtaagaaaaataaaaaaggcttttat
gaatatcctgaaagtggtaaaaaatacttgtgggaaggtttagctgagcatttcccaatt
tcaaaaatacaacctgaagtagaagaagtaaaaaaacgattgttatatcgtcaggtggta
gagtcaatacgatgcatggatgaaggagtattgattacaaagttagatggaaatattggg
tcgattttagcttggggtttccctccttatgcgggtggaacacttaattttcctgagttt
gttggtaaagaaactttcttgaaagaagtagaaagattagcagatacttatggcgaaaga
tttagattaagctcaaaacagaaggagttggttatgaatctttga

DBGET integrated database retrieval system