KEGG   Emticicia oligotrophica: Emtol_0789Help
Entry
Emtol_0789        CDS       T02272                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eol  Emticicia oligotrophica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Emtol_0789
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Emtol_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523774..524679
Genome map
AA seq 301 aa AA seqDB search
MSKKIYVIGSSNTDMVVKSEKLPVAGETILGGTFLMNAGGKGANQAVAAAKLGANVTFVS
KVGDDIFGKQAIQGFQKEGINTNFVFTDAENPSGVALILVDAKGENSIAVASGANGNLQI
SEVAKAIEQISANDIVLLQLEIPIPTVEFAIKKCSENGAKVILNPAPAQKLNENIFKFLE
IITPNETEAELLTGIKVTDLESAKHAAEVLHQKGVKNIIITLGSRGAYLYNTNTNLLISA
PQVQAVDTTAAGDVFNGALAVALSEGNEMEQAINFACKAAAISVTRMGAQASAPLRSEIN
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaatatacgtaattggtagttcaaataccgatatggtcgtaaaatccgaa
aaattaccagtcgcaggagaaactattcttggaggtacttttttaatgaatgctggcgga
aaaggagcaaatcaggcagtagcagcggcaaaattaggagcaaatgtaacgtttgttagt
aaggttggcgatgatatatttggtaaacaagccattcaaggcttccaaaaagaaggcatc
aataccaattttgtctttactgatgccgaaaacccttcaggcgtagcattgattttggtt
gatgccaaaggcgaaaacagcattgcagtagcttcgggagcgaatggaaatttacaaata
tcggaagtagcaaaagcgattgaacaaatttcagccaatgatatagttttactacaactt
gaaataccaattccgaccgtagaatttgccatcaaaaaatgctctgaaaatggtgcaaaa
gtaattttgaaccccgcacctgctcaaaagctgaatgagaatatttttaaatttctcgaa
atcatcactccaaatgaaactgaagcagaattacttacaggaataaaagttacagacctt
gagagtgccaaacacgcagcagaggttttgcatcaaaaaggggtaaaaaacataataatc
acgctgggttcaagaggtgcctatttatacaataccaacaccaatctattaattagtgct
cctcaagtacaagcagttgataccacagccgcgggcgatgttttcaacggtgctttggca
gttgcactttccgaaggaaatgaaatggaacaagctattaattttgcatgcaaagcagca
gcaatttcggtaactcgtatgggagctcaagcctctgctcctttgcggagtgagataaat
ttctaa

DBGET integrated database retrieval system