KEGG   Emticicia oligotrophica: Emtol_1007Help
Entry
Emtol_1007        CDS       T02272                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eol  Emticicia oligotrophica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Emtol_1007
  Lipid metabolism
   00561 Glycerolipid metabolism
    Emtol_1007
   00600 Sphingolipid metabolism
    Emtol_1007
Enzymes [BR:eol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Emtol_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781874..784075
Genome map
AA seq 733 aa AA seqDB search
MKKTLYLILFWISFYPLLAQTPQSIIPIETNDNALVLHIDKDNRVGVIYFGKKISQNAEY
ETLAKSLKYKDDNAGIYNSIYTPSGTWSLVESALEILHADGNTSTELKFVSHNIEKIDAN
VTQTNIVLRDPVYETQVTLSFKSYSKENIIEQWSTIKNQEKNTITLKKYASANLYFIAKD
YYLHHYHGSWAREMKPEDTKLTAGIKTLDSKLGTRANLYQPPTFMLSFDRQATEDEGKVL
LGTLAWSGNFKIDFEKDSYRNLRLIAGINPHASAYSLAANQEFQTPSFIYTYSENGKGEA
SKNMHNWARKYRILDGQGSRLTLLNNWEATYFDFDENKLTGLFKGAKDLGVDMFLLDDGW
FANKYPRNGDNAGLGDWQENKKKLPNGIGYLVKEATKAGVKFGIWVEPEMVNPKSELYEK
HLDWVIREPNRPETYFRNQLPLDLSNPDVQDYVFGVLDNLFTKNPELAFIKWDCNAVTYN
AHSMYLEKAKLPQSHLYVEYVRGLYKVLQRIRAKYPKVPMMLCSGGGGRVDYEALKYFTE
FWVSDNTDPMERIFMQWEYSYYYPAIAQCNHITDWSNVGIKFRTDVAMMGKMGYDIVVSK
LDEKELVFSQNALKNYNNLKEIIWHGDMYRLVNPFENQMASVQYVNEQKDHAVMFNYLVD
NRYDLTSLLSTTKLKGLDAKKKYKIKEINIYPGTKSTINEEIIYSGDYLMTIGINPNLSN
RRTSVVLEINEVK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacgctttaccttattttattttggattagtttttaccctttattggctcag
acgccacaaagcatcattccaatagaaacaaatgataatgctcttgtacttcacattgat
aaagataatcgtgtaggtgtgatttatttcggcaaaaaaatcagtcaaaatgctgaatat
gaaacccttgcaaaatcgttgaaatacaaagatgataatgctggaatttataattcgatt
tatacacccagcggaacttggagtttggtagaatctgcactagaaatcttacatgcagat
ggcaatacttcaactgagttgaaatttgtgagccataatattgaaaagattgatgccaat
gttacgcaaacaaatatcgttctccgagacccagtttatgaaactcaagtaactctttct
tttaaaagttattccaaagaaaatattattgagcagtggagtacgattaaaaaccaagaa
aaaaatacgataacactaaaaaaatatgcttcggccaatctgtatttcattgctaaagac
tattacttacatcattatcacggaagctgggcgagagaaatgaaacccgaagacactaag
ttaacagcgggcatcaaaacgcttgattctaaacttggtacaagagccaatttatatcag
ccgccaacctttatgctttcattcgatcgccaagcgaccgaagatgaagggaaagtttta
ctgggcactttagcttggtctggaaatttcaagatagattttgaaaaagactcttatcga
aatctccgactcatcgctggtataaatcctcatgcttcagcgtattcattggcagcgaat
caagaattccaaacaccttcgtttatttatacgtattcagaaaatggcaaaggtgaggcc
agcaaaaatatgcacaattgggcaagaaaatatagaattttagatggtcaaggttcaagg
ctcacccttctcaacaactgggaagcgacttattttgatttcgatgaaaacaaacttacc
ggtttgtttaaaggtgcgaaagatttaggcgtcgatatgtttttgttggatgatggttgg
ttcgctaataaataccctcgaaatggcgacaatgcaggtttaggcgattggcaagaaaac
aagaaaaaactacctaatggcataggatatttggtaaaagaagccaccaaagctggcgta
aaatttgggatttgggtagaacccgaaatggttaatccaaaatcagaattatatgaaaaa
cacctcgattgggtaattcgtgagccaaacagaccagaaacatatttccgtaatcaactt
ccactcgatttatctaaccctgatgtacaagattatgtatttggtgtactagacaatctt
tttaccaaaaatcctgaattagcttttatcaaatgggattgcaacgctgtaacttataat
gcacattcaatgtatttagagaaggcgaaactcccgcaatctcatttatacgttgaatat
gtacgtggtctttacaaagttcttcaacgtattcgagctaaatatccaaaagtacctatg
atgctttgctctggtggaggtggtcgtgttgattatgaagctttaaaatattttaccgaa
ttttgggtttcagataatacggacccgatggaacgcatttttatgcaatgggaatattct
tactactacccagctattgcccagtgcaatcatataactgattggagcaacgtaggaatc
aaatttcgtacagatgtggccatgatgggcaaaatggggtacgatatcgtggtaagcaaa
ttagatgaaaaagaactggtattcagtcaaaatgctctaaaaaactataataatcttaaa
gaaatcatttggcatggcgatatgtatagattagtcaatccatttgaaaatcagatggcc
tctgtacaatacgtaaatgagcaaaaagaccacgccgttatgtttaattatttagtagat
aatcgttatgacctaacatcacttctatcgactactaaactcaaaggtcttgatgccaag
aaaaaatacaaaatcaaagaaataaatatttaccccggcacaaaatctaccattaatgaa
gaaatcatttattcgggcgattatctaatgacaatcggaatcaatccaaacctttctaat
cgccgaaccagtgttgtactcgaaatcaatgaagtaaaataa

DBGET integrated database retrieval system