KEGG   Emticicia oligotrophica: Emtol_1010Help
Entry
Emtol_1010        CDS       T02272                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eol  Emticicia oligotrophica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_1010
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_1010
  Amino acid metabolism
   00310 Lysine degradation
    Emtol_1010
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Emtol_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788227..789777
Genome map
AA seq 516 aa AA seqDB search
MAIEMKVPSVGESVSEVTIASWTKKDGDLVKMDEVICELESDKATFELPAEADGILRIVA
PEGTTLPIGALICKIEAAGSTAAAAPAAAEAPKAVAEAPAAPVATKVIDVVVPAVGESIS
EVTIAAWSKKEGDSVKMDEVICELESDKATFELPSPENGVLTIVAQAGQVVPIGGVVAKI
TVGGSQSVAGGVPLSSPQPVAPVTQNSELKTQNSENYAAGHPSPVAAKVLAEKGIDPASV
QGTGVGGRITKDDAVKAEKPAVTPAPQVAKPAATPAAAPASEEGRSSRREKMTSLRKTIA
KRLVAVKQETAMLTTFNEVDMKPIMDLRAKYKDKFKEVHGVGLGFMSFFTKACAIALKEF
PLVNSYIDGDEIVYNDYADIAIAVSAPRGLVVPVIRSAEKLNFAQIESEVVRLAVKAREN
KLTIEEMTGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVERPVVVNGEIVVRPIMY
VALSYDHRTIDGKDSVSFLVRVKQLLEDPTRILLGV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaaatgaaagtcccttcggtgggcgaatcagtaagcgaagtaaccatcgct
tcttggacaaaaaaagacggtgatttagtgaaaatggacgaggttatctgcgaattagag
tcagataaagctactttcgaattacccgccgaagccgacggaattctaagaatagtagct
ccagaaggaacaacccttccaattggggcattgatatgtaaaatcgaagctgcgggaagt
acagcagcagcagctcctgcggcagctgaagctccaaaagcagtggccgaagcaccagca
gctccagttgctacgaaagtaattgatgtagttgtaccagcagttggtgaatcaatttca
gaggttaccattgctgcttggagcaaaaaagaaggtgatagcgtaaaaatggacgaagtt
atctgcgaactcgaatcagataaagctactttcgaattaccttcaccagaaaatggagta
ttgacaatcgttgcacaagcgggtcaagttgtaccaattggcggagtagtagctaagatt
acagttggcggctctcagtcggtagcgggcggcgttccgcttagcagtcctcaaccagta
gcacctgtaactcagaactcagaactcaaaactcagaactcagaaaactatgcagcaggt
catccatcaccagtagcagcgaaagttttagccgaaaaaggtatcgaccctgcttctgtt
caaggtacaggtgtaggtggacgtatcacgaaagacgatgcagtaaaagctgaaaaacca
gcagttactcctgcaccacaagtcgcaaaaccagcagccactccagctgcagcacctgct
tcagaagaaggaagatcgtctcgtcgtgaaaaaatgacttcattgcgtaagacaatcgcc
aaacgtctggtggcagtaaaacaagaaacagcgatgctcacaaccttcaacgaggttgac
atgaaaccaatcatggatttaagagcaaaatataaagataaattcaaagaagtacacggc
gtaggtttaggctttatgtcgttcttcacgaaggcatgtgccattgcgttgaaggaattc
cctttggtaaattcatacatcgatggcgatgaaatcgtgtataacgactatgccgatatt
gcaattgcggtttctgctccacgtggtttggttgttccagtaattcgtagtgcagaaaaa
ctaaacttcgctcaaatcgagtcagaagtagttcgtttggcggtaaaagcacgtgaaaat
aagttgacaattgaagaaatgactggaggtaccttcacaattaccaatggtggtatcttt
ggttcgatgctttctacgccaattatcaacgctccacaatcagctatcttgggtatgcac
aacatcgttgagcgtccggtagtagtaaatggagaaatcgttgttcgcccaattatgtac
gtggctcttagctatgaccaccgcaccattgacggaaaagattcggttagtttcttagta
agagtaaaacaactcttagaagaccctactagaattcttttgggtgtgtaa

DBGET integrated database retrieval system