KEGG   Emticicia oligotrophica: Emtol_1026Help
Entry
Emtol_1026        CDS       T02272                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eol  Emticicia oligotrophica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_1026
   01230 Biosynthesis of amino acids
    Emtol_1026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_1026
   00030 Pentose phosphate pathway
    Emtol_1026
   00051 Fructose and mannose metabolism
    Emtol_1026
   00052 Galactose metabolism
    Emtol_1026
  Energy metabolism
   00680 Methane metabolism
    Emtol_1026
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Emtol_1026
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Emtol_1026
Protein phosphatases and associated proteins [BR:eol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Emtol_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(803293..804267)
Genome map
AA seq 324 aa AA seqDB search
MKRIAVYTSGGDAPGMNACIRAAVRGAIYHGLEVYGIRRGYNGMIAGDIFPMNSQSVSNI
VQRGGTILKSARSKEFMTPEGRKKAYENLMNLGIEGLVAIGGNGTFTGAEVFYNEYEIPT
VGCPGTIDNDLYGTDYTIGFDTAVNTSLEAIDKIRDTADSHDRVFFIEVMGRDSGYIAIQ
SGIGGGAEIVMVPETHTPLKKVVSTLKDGWSRSKSSSIVVVAEGDEEGHAVDIAEKIKGQ
VADKLDIRVTTLGHIQRGGTPTAYDRILASRLGLGAVEGLIKGYKNVMAGIVNNELVYTP
FIDTIKKPKPIHDDLLRMVHILSM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatagcagtttatacatctggaggtgacgcacctggtatgaatgcctgcatt
agagcggcagttagaggtgccatctatcatggtttagaagtttacggaattagaagagga
tataatggaatgattgcgggagatattttcccaatgaactcgcagtcagtaagtaatata
gtgcaaagaggaggtaccatcctgaaatcagcgagaagtaaggagtttatgactcctgaa
ggaagaaaaaaagcctacgaaaacttaatgaatttaggtatagaagggcttgtagcaatt
ggtggaaacggtacatttacaggagctgaggttttctacaacgaatacgaaataccaaca
gttggctgccccggaactattgataatgacctttatggtactgattatacgattggtttc
gatactgcagtaaatacttcacttgaagcaattgataaaattagagatacagccgattcg
catgaccgcgtattttttatcgaagtaatgggccgtgactcaggttatatcgcaatccaa
tcaggtattggtggtggtgctgaaatcgtaatggttcctgaaacacatacaccattgaaa
aaagtggtgagtactctgaaagatggttggtctcgctcaaaatcttcttcaattgtagta
gtagctgaaggtgatgaagaaggccacgcggttgatatcgcagaaaagattaaaggacaa
gtggctgataaattagatattcgtgtaacaacactcggacacatccaacgtggtggtaca
ccaactgcttacgaccgtattcttgctagccgtttaggtttaggagcggttgaagggctt
atcaagggctacaaaaatgttatggcaggaattgtaaacaatgaattggtttatacacca
tttattgatacaatcaaaaaacctaagccaattcatgatgatttattgagaatggtacac
attctaagtatgtaa

DBGET integrated database retrieval system