KEGG   Emticicia oligotrophica: Emtol_1096Help
Entry
Emtol_1096        CDS       T02272                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eol  Emticicia oligotrophica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(882114..884111)
Genome map
AA seq 665 aa AA seqDB search
MAKKATSSKKATSTEQEPVNAESQAVVSTPSFGKVESFSLLTDFDISLFRSGKHYRMYEK
LGSHVVQNQGVTGTLFAVWAPNATYVSVIGNFNGWNRGEHPLNPRWDGSGIWEGWIPNIG
NGEVYKYFIASNTGADIEKGDPYALRWEHPPQTASIVWDTWYEWKDQDWMKTRRAKNALT
APLSVYEVHFGSWQRDPSDNDRRLSYREVADRLVPYVKEMGFTHVEFMPIMEHPYEPSWG
YQITGYFAASSRFGTPQDFMYLIEQLHMNGIGVLLDWVPSHYPGDAHGLYRFDGTALYEH
EDPREGYHPDWKSYIFNYGRYEVRSFLISNAIFWLDRFHADGLRVDAVASMLYRDYSRNA
GEWVPNVFGGRENLEVISLFKELNEEIYKSFPDTQTIAEESTAFPGVSRPVYTGGLGFGM
KWMMGWMNDTLRYFAKDPMYRKWHQNDITFSLVYAFSENFMLPLSHDEVVYGKGSLIDKM
PGDEWRKFANLRLLFAYMFTHPGAKLLFMGGEFAQFAEWNFQQSLDWHLYNNQPNKGVSE
LIKDLNKLYRAEGALFDKQFSPEGFEWIDTSDRDNAVIVYARKGFNEKDNLIVVLNFTPV
PRTNYRVGVPNAGTYAEVFNSDKTQYWGSGVVNGDVKTQAVATHGKPNSVELSLPPLGAV
VLKFR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaagcaacttcttcaaaaaaagcaacaagtaccgaacaagaacctgtaaat
gcggagtcgcaagcggtagtatctaccccgagttttggcaaggttgaatcattttctctt
ttaaccgacttcgatatttcgctttttcgctcaggcaaacactaccgaatgtacgaaaag
ttggggtctcatgtggttcaaaatcagggagttacgggtacactctttgctgtttgggct
cctaatgctacttatgtgtcggttattggtaatttcaatggttggaatcgtggtgaacat
ccactaaatcctcgttgggatggctcaggtatttgggaaggttggattccgaacattgga
aatggagaggtttataaatactttattgcttcaaataccggagctgatattgaaaagggc
gacccctatgcccttcgttgggagcatccaccacaaacggcttcaatcgtttgggatact
tggtatgaatggaaagaccaagattggatgaaaacccgtcgtgcgaagaatgctttgact
gctccactttcagtttatgaggtgcattttggctcatggcaacgcgatccatctgataat
gaccgacgtctttcgtaccgtgaggtggctgatagattggttccttacgtaaaggaaatg
ggctttacccatgtagagtttatgccaatcatggagcacccttatgaaccttcatggggt
tatcagattacgggttattttgcggcgagtagccgttttggtacaccacaagattttatg
tatctcattgagcaactccacatgaatggaattggtgtattgctcgactgggttccttca
cattacccaggtgatgcacatggtctttatcgttttgatggaactgccctatacgagcat
gaagacccacgcgaaggatatcacccagattggaaaagctatatatttaattacggccgc
tacgaagtacgctcatttttgattagtaatgctattttttggctcgaccgcttccatgct
gatggtttgcgagtagatgcggtagcttctatgttatatagagattattctcgtaatgca
ggtgagtgggttccgaatgtttttggaggtcgtgaaaatttggaagtaatttcattgttt
aaagaacttaacgaagaaatatataagagtttccctgatacacagaccattgcagaagaa
tcaactgcttttccaggtgtttctcgcccagtttatacaggtggtttgggctttggcatg
aagtggatgatgggttggatgaacgatacgcttcgctattttgctaaagacccaatgtat
cgtaaatggcaccaaaatgatattacctttagtttggtgtatgcattctccgaaaacttt
atgttaccactttcacacgatgaggtggtatatggaaaaggctctttaattgataaaatg
cctggcgatgaatggcgtaaatttgccaatctacgcttgttatttgcttatatgtttaca
caccctggtgcaaaattactctttatgggtggtgagtttgctcagtttgccgagtggaat
ttccaacaaagccttgattggcatttgtacaataatcaaccgaataaaggtgtaagcgaa
ttgattaaagacctaaacaaactgtatcgagcggaaggtgctttatttgataaacaattt
agtccagagggttttgaatggattgataccagcgaccgagataatgcggtaattgtttat
gctcgtaaaggatttaatgaaaaagataatctgattgttgtgttaaactttacgcctgta
ccacgtaccaactaccgtgttggtgtgccaaatgcaggtacttacgctgaggtatttaat
agtgataaaacacaatattggggaagtggtgttgtgaatggtgatgtgaaaacacaagca
gtagcaacgcacggaaaacctaattcagttgaactttcgctgccaccattaggagcggtt
gtattgaagtttagataa

DBGET integrated database retrieval system