KEGG   Emticicia oligotrophica: Emtol_1140Help
Entry
Emtol_1140        CDS       T02272                                 

Definition
glycoside hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
eol  Emticicia oligotrophica
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Emtol_1140
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Emtol_1140
Enzymes [BR:eol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Emtol_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932022..933398
Genome map
AA seq 458 aa AA seqDB search
MKKLYSLLLCAWALQSNAQNIETWLTYKDKSVLFQKQSNTLTFSKISNTSPSIYVDDSKT
FQKMDGFGYTLTGGSTLLLSQMPAAERAKILKELFAIDGNNIGVSYLRISIGASDLDDHV
FSYDDLPTGETDTKLTKFSLAEDKKHLIPVLKEILSINPQIKVLGSPWSPPSWMKTNHNS
KGGSLKPEYFGVYAQYLVKYVQEMKKEGIKIDAITIQNEPLHPGNNPSLLMPQDEQANFI
KKNLGPAFQQAKLPTKIIIYDHNADRPDYPISVLNDTEARKFIDGSAFHLYGGSVENIRS
VHEAHPDKNLYFTEQWIGAPGNFAGDFSWHIRNLIIGASRNWCKTVLQWNVAADPKQNPH
TEGGCTECLGALTIGSDVVRNPAYYIIAHASKFVRPNSVRIASNITMSLPNVAFKTPSGK
TVLIVQNEGDKTQEFNIRYHNKQVTTSLVAGAVATYVW
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctactctcttttgctttgtgcatgggcactccaaagcaatgcccaaaat
attgaaacttggctcacctataaagacaaatcagtacttttccaaaagcaatcaaatacg
ctaacttttagcaaaattagcaatacttcgcccagtatttatgtagatgatagcaaaact
tttcagaaaatggatggttttggctatactcttacgggtgggagtacactacttttaagc
caaatgccggctgctgaaagagcgaaaattttaaaagaattatttgctatcgatgggaat
aatattggtgtgagttatttaagaataagcattggggcatctgaccttgatgaccacgtt
ttttcgtacgatgaccttcctactggagaaacagatactaaattaacaaaatttagtttg
gctgaagataaaaaacacctcattccagttttgaaggaaattttgagcattaacccacaa
atcaaagttttgggttcgccgtggtcgccaccttcttggatgaaaacaaaccataactct
aagggtggaagtctaaaacctgagtattttggtgtttatgcccaatatttggttaaatat
gttcaggaaatgaagaaagagggtattaagatagatgccatcacgattcaaaacgaacca
ctacacccaggcaataatccaagcttattgatgccccaagatgagcaagctaattttatc
aagaaaaatctgggaccagcttttcaacaagccaaacttccaaccaaaatcatcatttat
gatcacaacgccgaccgaccagattacccaataagtgtattgaatgatacagaagcccgt
aaatttattgacggctcggcctttcatttatatggaggaagtgtagaaaacatcagaagt
gtacacgaggcacatcccgataaaaacttgtatttcaccgagcaatggattggtgctccg
ggaaatttcgctggagatttttcatggcatatccgtaacctaatcattggagcttcaagg
aattggtgtaaaacagttttgcaatggaatgtagctgccgaccctaagcaaaatccgcat
acagagggaggttgtactgagtgtttaggtgctttaacgattggctcagatgtggttaga
aacccagcatactacatcattgctcatgcttcaaaatttgttcgtccaaactccgttcga
attgcttcaaatattacgatgtcattgcccaatgtggcttttaaaacaccttctggtaaa
acagttcttattgttcaaaatgaaggtgataaaacgcaagaatttaatattcgttatcac
aacaaacaagttacaaccagccttgtagcaggggctgtagcaacctatgtttggtaa

DBGET integrated database retrieval system