KEGG   Emticicia oligotrophica: Emtol_1140Help
Entry
Emtol_1140        CDS       T02272                                 

Definition
glycoside hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
eol  Emticicia oligotrophica
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:eol00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eol00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932022..933398
Genome map
AA seq 458 aa AA seqDB search
MKKLYSLLLCAWALQSNAQNIETWLTYKDKSVLFQKQSNTLTFSKISNTSPSIYVDDSKT
FQKMDGFGYTLTGGSTLLLSQMPAAERAKILKELFAIDGNNIGVSYLRISIGASDLDDHV
FSYDDLPTGETDTKLTKFSLAEDKKHLIPVLKEILSINPQIKVLGSPWSPPSWMKTNHNS
KGGSLKPEYFGVYAQYLVKYVQEMKKEGIKIDAITIQNEPLHPGNNPSLLMPQDEQANFI
KKNLGPAFQQAKLPTKIIIYDHNADRPDYPISVLNDTEARKFIDGSAFHLYGGSVENIRS
VHEAHPDKNLYFTEQWIGAPGNFAGDFSWHIRNLIIGASRNWCKTVLQWNVAADPKQNPH
TEGGCTECLGALTIGSDVVRNPAYYIIAHASKFVRPNSVRIASNITMSLPNVAFKTPSGK
TVLIVQNEGDKTQEFNIRYHNKQVTTSLVAGAVATYVW
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctactctcttttgctttgtgcatgggcactccaaagcaatgcccaaaat
attgaaacttggctcacctataaagacaaatcagtacttttccaaaagcaatcaaatacg
ctaacttttagcaaaattagcaatacttcgcccagtatttatgtagatgatagcaaaact
tttcagaaaatggatggttttggctatactcttacgggtgggagtacactacttttaagc
caaatgccggctgctgaaagagcgaaaattttaaaagaattatttgctatcgatgggaat
aatattggtgtgagttatttaagaataagcattggggcatctgaccttgatgaccacgtt
ttttcgtacgatgaccttcctactggagaaacagatactaaattaacaaaatttagtttg
gctgaagataaaaaacacctcattccagttttgaaggaaattttgagcattaacccacaa
atcaaagttttgggttcgccgtggtcgccaccttcttggatgaaaacaaaccataactct
aagggtggaagtctaaaacctgagtattttggtgtttatgcccaatatttggttaaatat
gttcaggaaatgaagaaagagggtattaagatagatgccatcacgattcaaaacgaacca
ctacacccaggcaataatccaagcttattgatgccccaagatgagcaagctaattttatc
aagaaaaatctgggaccagcttttcaacaagccaaacttccaaccaaaatcatcatttat
gatcacaacgccgaccgaccagattacccaataagtgtattgaatgatacagaagcccgt
aaatttattgacggctcggcctttcatttatatggaggaagtgtagaaaacatcagaagt
gtacacgaggcacatcccgataaaaacttgtatttcaccgagcaatggattggtgctccg
ggaaatttcgctggagatttttcatggcatatccgtaacctaatcattggagcttcaagg
aattggtgtaaaacagttttgcaatggaatgtagctgccgaccctaagcaaaatccgcat
acagagggaggttgtactgagtgtttaggtgctttaacgattggctcagatgtggttaga
aacccagcatactacatcattgctcatgcttcaaaatttgttcgtccaaactccgttcga
attgcttcaaatattacgatgtcattgcccaatgtggcttttaaaacaccttctggtaaa
acagttcttattgttcaaaatgaaggtgataaaacgcaagaatttaatattcgttatcac
aacaaacaagttacaaccagccttgtagcaggggctgtagcaacctatgtttggtaa

DBGET integrated database retrieval system