KEGG   Emticicia oligotrophica: Emtol_1148Help
Entry
Emtol_1148        CDS       T02272                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eol  Emticicia oligotrophica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eol00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939429..940400
Genome map
AA seq 323 aa AA seqDB search
MLISRPRRNRKSAAIRALVQETTLSVDDFIFPMFVMEGSGIKSEIKSMPNIYRFSIDTLL
EEMKEVSDLGIKSICLFPNYPESKKDKYATESYKADTLYLRALSEIKEKFPHIALMTDVA
MDPYSSDGHDGLVENGEILNDETLDILGKMALAQARAGADILGPSDMMDGRIGYIRELLD
DEGFTNVSIMSYSVKYASAFYGPFRDALDSAPKFGDKKTYQMNPANVREALIEGQLDVAE
GADFLMVKPAFSYLDVIKTMADNFDLPIAAYNVSGEYAMIKAAAQNGWLDGEKAMLEMLL
SIKRAGAKIILSYFAKEFALLKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcagtcgcccacgtagaaatagaaaaagtgctgccatcagggctttagtacaa
gaaactaccctttcggtagatgattttatctttccaatgtttgtcatggaaggttcggga
attaagagcgagataaaatcaatgcccaatatttatcgcttttcgatagatacactttta
gaagaaatgaaagaggtatctgatttaggcataaaatcaatttgccttttcccgaattat
ccagaatcgaaaaaagataaatatgccacagaaagctataaagctgatactttatattta
agagcattgagtgaaatcaaggaaaaattcccgcatatcgcccttatgactgatgtagct
atggacccttacagtagcgatggccatgacggtttggtagaaaatggcgaaattctcaac
gatgaaacactcgatattttaggcaaaatggcccttgctcaagcacgtgcaggagccgat
attcttgggccttctgatatgatggatggacgcattggttacattcgtgaactccttgat
gatgaaggctttacgaatgtgagtattatgtcttattcggtgaaatatgctagtgcattc
tacggtccattccgtgatgccctagattctgccccaaaattcggtgataaaaaaacttat
caaatgaaccccgccaatgtgcgtgaggcactcattgaaggtcagctcgatgtggcagaa
ggtgctgatttcttgatggtaaaaccagcattctcttatttggatgtgattaaaacaatg
gctgataacttcgatttacctattgctgcttataatgtttctggcgaatatgctatgatt
aaagctgctgcacaaaatggctggctcgatggagaaaaagccatgctcgaaatgcttttg
agcatcaaacgagcaggtgcaaaaatcatcttgagttattttgctaaagaatttgccttg
ttgaaaaaataa

DBGET integrated database retrieval system