KEGG   Emticicia oligotrophica: Emtol_1148Help
Entry
Emtol_1148        CDS       T02272                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eol  Emticicia oligotrophica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Emtol_1148
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Emtol_1148
Exosome [BR:eol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Emtol_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939429..940400
Genome map
AA seq 323 aa AA seqDB search
MLISRPRRNRKSAAIRALVQETTLSVDDFIFPMFVMEGSGIKSEIKSMPNIYRFSIDTLL
EEMKEVSDLGIKSICLFPNYPESKKDKYATESYKADTLYLRALSEIKEKFPHIALMTDVA
MDPYSSDGHDGLVENGEILNDETLDILGKMALAQARAGADILGPSDMMDGRIGYIRELLD
DEGFTNVSIMSYSVKYASAFYGPFRDALDSAPKFGDKKTYQMNPANVREALIEGQLDVAE
GADFLMVKPAFSYLDVIKTMADNFDLPIAAYNVSGEYAMIKAAAQNGWLDGEKAMLEMLL
SIKRAGAKIILSYFAKEFALLKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcagtcgcccacgtagaaatagaaaaagtgctgccatcagggctttagtacaa
gaaactaccctttcggtagatgattttatctttccaatgtttgtcatggaaggttcggga
attaagagcgagataaaatcaatgcccaatatttatcgcttttcgatagatacactttta
gaagaaatgaaagaggtatctgatttaggcataaaatcaatttgccttttcccgaattat
ccagaatcgaaaaaagataaatatgccacagaaagctataaagctgatactttatattta
agagcattgagtgaaatcaaggaaaaattcccgcatatcgcccttatgactgatgtagct
atggacccttacagtagcgatggccatgacggtttggtagaaaatggcgaaattctcaac
gatgaaacactcgatattttaggcaaaatggcccttgctcaagcacgtgcaggagccgat
attcttgggccttctgatatgatggatggacgcattggttacattcgtgaactccttgat
gatgaaggctttacgaatgtgagtattatgtcttattcggtgaaatatgctagtgcattc
tacggtccattccgtgatgccctagattctgccccaaaattcggtgataaaaaaacttat
caaatgaaccccgccaatgtgcgtgaggcactcattgaaggtcagctcgatgtggcagaa
ggtgctgatttcttgatggtaaaaccagcattctcttatttggatgtgattaaaacaatg
gctgataacttcgatttacctattgctgcttataatgtttctggcgaatatgctatgatt
aaagctgctgcacaaaatggctggctcgatggagaaaaagccatgctcgaaatgcttttg
agcatcaaacgagcaggtgcaaaaatcatcttgagttattttgctaaagaatttgccttg
ttgaaaaaataa

DBGET integrated database retrieval system