KEGG   Emticicia oligotrophica: Emtol_1204Help
Entry
Emtol_1204        CDS       T02272                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eol  Emticicia oligotrophica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_1204
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_1204
   00052 Galactose metabolism
    Emtol_1204
   00500 Starch and sucrose metabolism
    Emtol_1204
   00520 Amino sugar and nucleotide sugar metabolism
    Emtol_1204
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Emtol_1204
   00524 Butirosin and neomycin biosynthesis
    Emtol_1204
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Emtol_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1009402..1010292)
Genome map
AA seq 296 aa AA seqDB search
MKVAIGIDLGGTNVKGILMQEDGKILKQHYIPTKDDAKGKWRENVLEMVNFLRSFHQEPI
EMVGLSAPGLAHEDNRSIAHLPNRLFGLENFVWEEYFGIKTYVLNDAHAALMAEAKFGVM
QGYKNAVLLTLGTGVGGGIMINGQLHQGLSQMAGHLGHLSLNATDDELSILGMPGSLEYA
IGNCSIVRRSMGRFQSTHELVNAYHKNEPFATWLWLDSIRKLAIGIASLINALSPEIIVL
AGGITTAGSALFEPLHAFIELFEFRPKGKTTLIKQAEFADLSGAIGAAAFAFNQEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaattggaattgaccttggtggtacaaatgtcaaaggaatattgatgcag
gaagatggaaaaatcttgaaacaacattacattcccacaaaagatgatgctaaaggtaaa
tggcgagagaatgtccttgaaatggtcaatttcttgaggagttttcaccaagaacccatt
gaaatggttggactttcggctccaggtcttgcccatgaagataatcggagtattgcacat
ttacccaatcgcttatttggtttagaaaactttgtttgggaagaatattttggaatcaaa
acctatgttttgaatgatgcacacgctgctctgatggccgaagcaaaatttggcgttatg
caaggatacaaaaatgccgttttattgacactcggtacaggcgtaggagggggaatcatg
attaatgggcagttacaccaaggtttaagtcaaatggcggggcatttgggtcatctttca
ctcaatgcaaccgatgatgaattgagcattttgggtatgcccggtagtttagaatatgct
atcggaaattgttcgattgttcgccgctcgatgggtcgatttcaatcaactcatgagttg
gtcaatgcttatcataaaaacgaaccttttgctacttggctttggcttgattcaattaga
aaattagccattgggattgcttcattaattaatgctctttcgcccgaaatcattgtatta
gctggtggaattacaaccgcaggtagtgcattatttgagcctctacatgcatttattgag
ctttttgagttcagacccaaaggaaaaacaacgcttatcaagcaagccgaatttgctgat
ttgtcaggagccattggagctgccgcatttgccttcaatcaagaaaaataa

DBGET integrated database retrieval system