KEGG   Emticicia oligotrophica: Emtol_1204Help
Entry
Emtol_1204        CDS       T02272                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eol  Emticicia oligotrophica
Pathway
eol00010  Glycolysis / Gluconeogenesis
eol00052  Galactose metabolism
eol00500  Starch and sucrose metabolism
eol00520  Amino sugar and nucleotide sugar metabolism
eol00521  Streptomycin biosynthesis
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
Module
eol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_1204
   00052 Galactose metabolism
    Emtol_1204
   00500 Starch and sucrose metabolism
    Emtol_1204
   00520 Amino sugar and nucleotide sugar metabolism
    Emtol_1204
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Emtol_1204
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Emtol_1204
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Emtol_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N YSIRK_signal Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AFK02353
UniProt: I2ERQ0
Position
complement(1009402..1010292)
Genome map
AA seq 296 aa AA seqDB search
MKVAIGIDLGGTNVKGILMQEDGKILKQHYIPTKDDAKGKWRENVLEMVNFLRSFHQEPI
EMVGLSAPGLAHEDNRSIAHLPNRLFGLENFVWEEYFGIKTYVLNDAHAALMAEAKFGVM
QGYKNAVLLTLGTGVGGGIMINGQLHQGLSQMAGHLGHLSLNATDDELSILGMPGSLEYA
IGNCSIVRRSMGRFQSTHELVNAYHKNEPFATWLWLDSIRKLAIGIASLINALSPEIIVL
AGGITTAGSALFEPLHAFIELFEFRPKGKTTLIKQAEFADLSGAIGAAAFAFNQEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaattggaattgaccttggtggtacaaatgtcaaaggaatattgatgcag
gaagatggaaaaatcttgaaacaacattacattcccacaaaagatgatgctaaaggtaaa
tggcgagagaatgtccttgaaatggtcaatttcttgaggagttttcaccaagaacccatt
gaaatggttggactttcggctccaggtcttgcccatgaagataatcggagtattgcacat
ttacccaatcgcttatttggtttagaaaactttgtttgggaagaatattttggaatcaaa
acctatgttttgaatgatgcacacgctgctctgatggccgaagcaaaatttggcgttatg
caaggatacaaaaatgccgttttattgacactcggtacaggcgtaggagggggaatcatg
attaatgggcagttacaccaaggtttaagtcaaatggcggggcatttgggtcatctttca
ctcaatgcaaccgatgatgaattgagcattttgggtatgcccggtagtttagaatatgct
atcggaaattgttcgattgttcgccgctcgatgggtcgatttcaatcaactcatgagttg
gtcaatgcttatcataaaaacgaaccttttgctacttggctttggcttgattcaattaga
aaattagccattgggattgcttcattaattaatgctctttcgcccgaaatcattgtatta
gctggtggaattacaaccgcaggtagtgcattatttgagcctctacatgcatttattgag
ctttttgagttcagacccaaaggaaaaacaacgcttatcaagcaagccgaatttgctgat
ttgtcaggagccattggagctgccgcatttgccttcaatcaagaaaaataa

DBGET integrated database retrieval system