KEGG   Emticicia oligotrophica: Emtol_1289Help
Entry
Emtol_1289        CDS       T02272                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eol  Emticicia oligotrophica
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:eol00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126712..1128607
Genome map
AA seq 631 aa AA seqDB search
MKRFFSILLVSSLFFSTQTYAQALKVQHDLVVAKDGSGDFRYIQDAINAVRVYLPKPITI
KIKKGIYKEKLEVYSTLTNITFVGESLDSTIISYDDFSGKGKMETFDSYTLKVLGNDIKF
KNLTIENTAGRVGQAVALHVEGDRCVFENCKFLGNQDTIFASGENARQYFSKCYIEGTVD
FIFGSSTALFENCHIHSKTDGYVTAASTPKWVTYGYVFKDCKLTADKAATKVYLGRPWRD
FAKTVFINCEMDSHILPEGWNNWGRPETEKTTFYAEYGSKGEGAKMVNRVKWSHQLSEKE
AQQYTKEEIFSGKLLTQYQDFWSKTPSMKGITNVRDTSYSNYSALKSSLKTHPNATLVPE
KTPENVIEERNIVYANTGTRDLQLDAFYPKTKSKKLRPAILIIHGGGWRTGNRTQHIPLA
QRLAALGYATFTAEYRLSTEALYPAAVHDLKAALRWIRANAKKYGIDTNKIASVGFSAGG
QLSALIGNTNNLPKFEGSIGNLKHSSQTNAIVDIDGILAYIHPESGEGDDRKSTSAATYW
FGFSKDENPELWHEASALTYAGKNTPPTLFLNSSVDRMHAGREDYRKKLDAFGIYSEVHT
FENSPHSFCLLSPWFDPTIGYIDTFLKKVFK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttttcagtattctcttagtttcttcactattcttcagtacccaaacctac
gcccaagcacttaaagttcaacatgatttggttgtagccaaagatggtagtggcgatttt
cgctacatacaagatgccatcaatgccgtgcgagtttacttaccgaaacctattacaatc
aaaattaaaaaagggatttacaaagaaaaactcgaagtttatagtacacttacgaacatc
acttttgtgggcgaaagcctcgatagtaccatcatcagctacgatgatttttcgggaaaa
ggcaaaatggaaacctttgactcttacaccttaaaagtgttgggaaatgatattaaattc
aaaaacctcaccatcgaaaataccgcaggaagagtggggcaagctgttgctttgcacgta
gaaggcgaccgctgtgtatttgaaaactgtaaatttctgggaaatcaagacactattttt
gcttcgggcgaaaacgcaagacaatatttctcgaaatgctatatcgaaggcacagtcgat
tttattttcgggtcgtcaacggctttgtttgaaaactgtcatattcactccaaaaccgat
ggttatgttacggccgcttctacgccaaaatgggtgacttatggctatgtcttcaaagat
tgtaaactaacggccgataaagcagccaccaaagtttatttgggcagaccgtggcgagat
tttgccaaaactgttttcatcaactgcgaaatggacagccatattttgcccgaaggctgg
aataattggggcagaccagaaactgaaaaaacaactttctatgccgaatacggttcgaaa
ggtgaaggtgcaaaaatggtaaatagagtaaaatggtcgcaccaactgagtgaaaaagaa
gctcagcaatatactaaggaagaaattttctcaggaaaactactaacccaataccaagat
ttttggagtaaaacgccttccatgaaaggtatcacgaatgttcgagatacttcatacagt
aattatagtgcattgaaaagcagcctaaaaacgcacccaaatgccactttagtgccagaa
aaaacacccgaaaatgtaattgaagagcgaaacattgtctatgctaatactggcacgaga
gatttacaactcgatgcattctacccaaaaacgaagtctaaaaaactacgtcccgctatt
ctgattattcatggtggcggttggcgtacaggcaatcgtacacaacacattcctttggct
caacgcttggcagctttaggttacgcgacttttactgcagaatatcgtctttcaaccgaa
gccctctatcctgctgccgtacatgatttaaaagcagccttaagatggattcgagccaat
gccaagaaatacggcatagacaccaataaaattgccagcgtgggtttttcggcaggtggg
cagctttcggcactcattggaaataccaacaatttaccaaaatttgaaggaagcattggc
aatttgaaacattccagtcaaacaaatgctattgtggatattgatgggattttggcctat
attcacccagaatctggcgaaggagatgaccgaaaaagcacttcggctgctacttattgg
tttggatttagtaaggacgaaaaccccgaactatggcacgaagcctcggcacttacgtat
gcaggtaaaaatacgcctcctacccttttcttgaatagttcagttgacagaatgcacgct
ggccgtgaagattaccgcaagaaacttgatgcgtttggcatttactcagaagtacatact
tttgaaaattctccgcattcgttttgtttactttcgccttggtttgaccctacgattggg
tatattgatacatttttgaaaaaagtttttaagtaa

DBGET integrated database retrieval system