KEGG   Emticicia oligotrophica: Emtol_1302Help
Entry
Emtol_1302        CDS       T02272                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eol  Emticicia oligotrophica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eol00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1144915..1145700)
Genome map
AA seq 261 aa AA seqDB search
MSAVTEKIAQDRLRKVESILVTQPRPTDDKSPYFELAKKFNLKVDFRSFIEIRGLDHRDF
RRQKIDILAHTAVIFTSRNAVDNFFRIAKELRIEIPIDMKYFCISEQTANYLQKYIVIRK
RKIFVGQKTAADLEALILKHKSEKFLFPCSNIRSNDIPNLMNRNDLHLTEAVMYETVPSD
LSDLTEVFYDIICFYSPSGITSLNHNFPDWKQNNTRLAAFGPTTAKAIREAGFILDIEAP
LPNAPSMTGALELYIKKANNI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagtaacagagaaaatagctcaagaccgtctccgtaaagtggagagtatattg
gttacccaaccgagaccaacagatgacaagtctccgtattttgagttagccaaaaagttt
aatttaaaagtggattttcgctctttcatagaaataagaggcctagaccaccgtgatttt
cgtcgacaaaagattgatattttagcacacactgctgtaatttttactagtagaaatgct
gtcgataatttcttccgtattgccaaagaattgcgtatcgagataccaattgatatgaag
tatttttgtatttctgaacaaacggccaattatctacaaaaatacattgttattagaaaa
cgtaaaatatttgtaggtcagaaaacagccgctgatttagaggctctaattttgaagcat
aaaagcgaaaagtttttattcccttgctcaaatattcgtagcaatgatatcccaaatttg
atgaatcgtaatgatttgcacttaactgaagcagttatgtacgaaacagtgccttcagat
ttatcagatttaacagaggtattctacgatatcatttgtttctatagcccttcgggaatt
acatcgttgaatcataacttcccagactggaagcaaaacaatacgcgtttagcagctttt
ggtccaacaacagccaaggctattcgtgaagctggttttattcttgatattgaagctcca
ttgccaaatgctccttcaatgacaggagctctagaactttacataaaaaaagcaaacaac
atttaa

DBGET integrated database retrieval system