KEGG   Emticicia oligotrophica: Emtol_1395Help
Entry
Emtol_1395        CDS       T02272                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eol  Emticicia oligotrophica
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_1395
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Emtol_1395
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Emtol_1395
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Emtol_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266254..1267291
Genome map
AA seq 345 aa AA seqDB search
MIQKPILILKFGTASITQKNGEPDETIIADIARQVAILHADYQIVMVSSGAVGAGKHFIK
NYSGEIAERKAAAAIGNPLLLNIYSKYFSQYGIQIAQSLCERQHFGNREQFLQLKETYQE
LWENDIIPIANENDVVSNRELKFSDNDELATLIATGFGAETLMICTSVGGLLDKDKNIIR
KIENIDNQILGLVDNSKSALGSGGMASKLTFTKLATRMGIKVIIFGMKEQDGILKAIKGE
AGSEFSAQEVNLSSRNKWLASGSVAVGTLQIDAGAAKAIQKRSSLLAVGIRKIKGEFEIG
EVVEIVDNHGEMLAVARTKVSSVELAENLKTINYEVANANDIVLI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaacctatcctcatactaaaattcggaacggcttcgattactcaaaaaaac
ggagaacctgacgaaaccatcattgctgatattgctcgccaagtggccattcttcacgct
gattatcagatagttatggtatcttcgggtgcggtgggtgctggaaagcattttatcaaa
aattattcgggcgaaattgccgagcgtaaggccgccgctgccatcggaaacccacttttg
ttgaatatttactcgaaatacttctcacaatacggcattcagattgcccaaagcttgtgc
gaacgtcaacattttggcaaccgtgagcagtttttgcagttgaaagaaacttaccaagaa
ttgtgggaaaacgatattattccgattgccaacgaaaacgacgtagtgagtaaccgtgag
ttaaaattttcggataacgacgaattggcgacattaatcgccacaggtttcggagcagaa
acactgatgatttgtacttcggttggtggacttttagataaagacaaaaacatcattcgt
aaaatagaaaatattgataatcagattcttggcttggtcgataactcaaaatcggcactt
ggttcgggcggaatggcttctaaattaacttttacgaaactcgccactcgaatgggaatc
aaagtgattatttttgggatgaaagagcaagatggtatcttaaaagcaatcaaaggtgag
gcaggaagcgagttttcggcacaagaagtcaatctttcatcaagaaataaatggttggcc
agcggaagcgttgcggtaggcacattacaaattgatgcaggtgcagccaaagccattcaa
aagcgtagtagtttattagccgttggcatacgcaaaatcaaaggagaatttgagattggt
gaagttgtagaaattgtcgataatcacggcgaaatgctagccgttgcccgcacaaaggtt
tcttcggttgagttggccgaaaacctcaaaaccatcaattatgaagtagcaaatgccaac
gatattgtattgatttga

DBGET integrated database retrieval system