KEGG   Emticicia oligotrophica: Emtol_1603Help
Entry
Emtol_1603        CDS       T02272                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
eol  Emticicia oligotrophica
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Emtol_1603
Enzymes [BR:eol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Emtol_1603
Glycosyltransferases [BR:eol01003]
 Polysaccharide
  Storage polysaccharide
   Emtol_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1533259..1535127)
Genome map
AA seq 622 aa AA seqDB search
MATTKAKLKKESEETISIKPREQKKPMLMEIAWEVCNQVGGIYTVIRSKVPSMVEEWGEN
YCLVGPYFPNTAMIEFEPIADLDESPFGKVVKKMKEMGFDAHYGRWLVTGKPKIVLLDFK
SILNDTNDLKFKLWERHQISTLNAEPLVDQVIALGEMIRVFLTEFGEAFGSKNEVVAHFH
EWMVATALIDIRTDNVPISTVFTTHATMLGRYIAGNEPDFYEKLSGYDWEQEARHYGIEA
QAKIERLAAQKSHVLTTVSDVTAKECEVFFGRTCDLILPNGLNVTRFAAIHEFQNLHLKY
KEKIHQFVMGHFFQSYSWDLDNTLYFFTSGRYEFRNKGYDLTLEALKRLNFKLVQAGIDT
TIVMFIITKNPVHSIDPEVLQSRAVMEEIRQTCEAMEKQIGEHLFHASASNDDPNLPDLN
QFVDEYWRLRLRRTIQTWKTKKLPHTVTHLLKQPDDITNYLKETNLLNHEQDRVKFVYHP
DFISPTNPLFGMEYSQFVRGCHLGIFPSYYEPWGYTPLECVVRGIPTVTSDLSGFGDFIM
QLMKDFENVGVYVVNRKRKNFDKAADQLAEILFKFVTMNRRDRIMQRNRVENISEVFDWT
NLRSYYDTAHDLALKRKGITRI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaccaaagcaaaattaaagaaagaatcagaagaaactattagtattaagccg
cgtgaacaaaagaagccaatgttgatggagattgcttgggaggtatgtaaccaagttggt
ggaatttatacagtaattcgctcgaaagtaccttcaatggttgaggagtggggcgaaaat
tactgtctcgttggcccgtacttccctaatacggcaatgattgagtttgaaccaattgca
gacctcgatgaatcgccttttgggaaagttgtaaaaaaaatgaaagaaatgggctttgat
gcccattatggccgttggctggttacgggcaaacccaaaattgttttgctcgatttcaag
tcaattttgaatgataccaacgatttaaagtttaaactttgggaaagacaccaaatttca
actttaaatgctgagccattggttgaccaagtgattgctctaggtgagatgattagggtt
ttcttgaccgaatttggtgaagcttttgggagcaaaaacgaggttgtggctcattttcat
gagtggatggttgccactgctttgatagatattcgcactgataatgtgccaatttcgacc
gtatttactacacatgccaccatgttggggcgttatatcgctggaaatgagcctgatttt
tacgaaaaactatcaggatatgattgggaacaggaagcacgccattatggaatagaagca
caagcgaaaattgaacgtttagctgcccaaaaatcgcatgtactcactacagtaagtgat
gtgacagctaaagaatgtgaggtgtttttcggtcgaacttgtgatttgattctaccgaat
ggtctgaatgttacacgttttgcagctattcatgaattccagaatcttcacttgaaatat
aaagaaaaaatccatcaatttgtgatggggcacttcttccaaagttattcttgggattta
gataatacactctacttctttacttcaggccgctacgaatttagaaacaaaggatatgac
cttacacttgaagctctcaaacgtttgaacttcaaacttgttcaggcaggtattgatacg
acaatcgtgatgtttatcattactaaaaaccctgttcattcgatagacccagaggtgcta
cagtcgagggctgtaatggaagagattcgacaaacctgtgaggctatggaaaaacaaatt
ggagaacatctattccatgcctcggcatcaaacgatgacccaaatcttcctgacttaaat
cagtttgttgatgaatattggagattacgtttacgccgcacaattcaaacttggaagacc
aaaaaacttcctcatacggtgacgcaccttttgaagcaacccgatgatattaccaattat
ttgaaggaaaccaatttacttaaccacgaacaagaccgcgtaaaatttgtgtatcaccca
gattttatttctcctaccaacccactttttggaatggaatacagccagtttgtgcgtgga
tgccatttgggcattttcccgagttattatgaaccttggggatatacgccgctagagtgt
gttgtaagaggaattcctactgtaacgagtgatttatcaggctttggtgatttcattatg
caactcatgaaagatttcgaaaacgtaggggtatatgtggttaatcgtaagcgtaaaaac
tttgataaagccgccgaccaactagccgaaattctctttaagttcgtaacaatgaaccga
cgtgaccgcatcatgcagcgtaatagagtagagaatatctcagaagtatttgattggaca
aatctacgttcgtactacgatactgctcacgatttagccctgaaacgtaagggtataaca
cgtatatag

DBGET integrated database retrieval system