KEGG   Emticicia oligotrophica: Emtol_1615Help
Entry
Emtol_1615        CDS       T02272                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eol  Emticicia oligotrophica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Emtol_1615
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Emtol_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1546252..1547403
Genome map
AA seq 383 aa AA seqDB search
MQKRHLAILGSTGSIGTQALEVVEANPDIFEVEVLTAQNNADLLIEQAAKFKPNVVVISN
ENLYDKVFAALDPLDIKVYSGDKSLASVVTMESVNMVLTALVGYAGLIPTVAAIKAGKHI
ALANKETLVVAGELVTELAQKHRVDILPVDSEHSAIFQCLVGEFHNPIEKIILTASGGPF
RGKDREFLKTVTKAQALKHPNWSMGAKITIDSASLMNKGLEVIEAKWLFGLTPEQIEVVV
HPQSIIHSMVQFEDGSMKAQMGLPDMRVPIQFAIGYPNRLKSTFPRMDFAQYPSLTFEKP
DYETFRNLGFAFEALRTGGNMACIVNAANEIAVAAFLRDEIGFLEMSDLIEDCMKKVTFV
RTPTLEDYIETDKETRRLALEFV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacgtcatcttgctattcttggctcaactggttctatcggaacacaagcctta
gaagttgttgaagccaatccagatatttttgaagtagaagtactgaccgcccaaaacaac
gccgatttgttgattgaacaagcagctaagtttaagccaaacgtagtggtgatttctaac
gaaaacctttatgacaaagtctttgccgctctcgacccacttgatataaaagtttattct
ggagataaatctttggcatcggttgtaaccatggaatcggtgaatatggtactcactgct
ctggtgggttatgcaggacttattccgacggtggcggccattaaagcaggtaaacacatt
gctttagccaataaagaaacgctcgtagtagctggcgaattagtgacggaattagctcaa
aagcatagagttgatatattacctgttgattctgaacattcggctatttttcagtgcttg
gtaggtgagtttcataatcctattgaaaaaataatactaacggcttcgggtggtccattt
agagggaaagaccgtgagtttttgaaaacagttaccaaagcccaagccctcaagcaccct
aattggagcatgggagcaaaaattaccatagattctgcttctttgatgaataagggttta
gaggtaattgaagcaaagtggttattcggactcacaccagagcaaattgaagtggttgta
cacccacaaagtattattcactcaatggtgcagtttgaagatggaagtatgaaagcccaa
atgggtttaccagatatgcgagtgccgattcagtttgcgattggctatccgaatcgttta
aaatcaactttcccacgtatggattttgcccagtatccatcgcttacttttgaaaaacct
gattatgaaacattcagaaatttaggtttcgcatttgaagccctacgtactggcgggaac
atggcgtgtattgttaatgcggccaacgaaatagccgttgcagcattcttacgtgatgaa
atcggattcttagaaatgtcggatttgattgaagattgtatgaaaaaagtgaccttcgtt
cgcacaccaacgctcgaagattatatagaaaccgacaaagaaaccaggcgtctggcttta
gagtttgtttaa

DBGET integrated database retrieval system