KEGG   Emticicia oligotrophica: Emtol_1618Help
Entry
Emtol_1618        CDS       T02272                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eol  Emticicia oligotrophica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Emtol_1618
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Emtol_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549595..1550419
Genome map
AA seq 274 aa AA seqDB search
MLTFPNAKINIGLNIVEKRSDGFHNIESVFYPVEWCDALEILPNQDQTANEAIFQSTGLS
IPGNESSNLCLKAWHLLQDQISTPPTIHLHKVIPMGAGLGGGSADGAFTLRMLNEVYQLN
LSNDQLKDFARKLGSDCAFFIENKPVFCYNKGDEFEDFSLNLKGKFIVLVNPDIHISTAE
AYSGVSPQKPEISLKTALSEPISNWKTIVKNDFEEKLLLKYPTIAEVKESLYVAGAVYAS
MTGSGSTVYGIFENEIDLKNQFPNFAIWQGFFKV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttacatttccaaacgctaaaataaacattggcctcaatatcgtagaaaaacgctct
gatggcttccataatatcgaatctgttttttacccagtcgaatggtgcgatgccctcgaa
atcttaccaaatcaagaccaaactgccaatgaagcaatcttccaaagtacgggcttgagt
attccgggcaatgaaagttcaaatctttgtttgaaggcatggcatttattgcaagaccaa
atctctacgccaccgactattcatttgcacaaagtaataccaatgggtgcaggcttgggt
ggtggttctgccgatggagcttttacacttcgcatgctcaatgaggtttatcaactaaat
ttgagcaacgaccaactaaaagattttgcccgaaaattaggttcggactgtgcttttttc
atcgaaaataaacctgttttttgctataataaaggcgatgaatttgaagatttttcgctt
aatctgaaagggaaatttatagtgttagtcaatccagatattcatatttctactgctgaa
gcttattcgggggtatcgccacaaaaacctgaaatatcattaaaaacggctctttcggag
ccaatatctaattggaaaacaattgttaaaaacgatttcgaagaaaaactgttattaaag
tatccaaccattgccgaagtaaaagaatcactttatgtagctggtgctgtttatgcttct
atgacgggctcaggctcaactgtatatggaatttttgaaaacgaaatagacttaaaaaat
caatttccaaatttcgcaatatggcaaggattctttaaagtataa

DBGET integrated database retrieval system