KEGG   Emticicia oligotrophica: Emtol_1663Help
Entry
Emtol_1663        CDS       T02272                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
eol  Emticicia oligotrophica
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Emtol_1663
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Emtol_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1612482..1613084
Genome map
AA seq 200 aa AA seqDB search
MKGKAIIFCAPSGSGKTTIVKHLLDKYTNLGFSISACTRDKRGRNEENGKDYYFLSIHDF
KERIDRDEFVEWQEVYPGAYYGTLKTEIERLWDEGKNVIFDVDVKGGMNLKRYFGDNALA
IYVKVPSMEELERRLRSRGTDDEDSISRRIYKMKFEMEFQDKFDVILHNDDIQHSWQKAE
ELYEQFTKNELVITKKPLEV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtaaagcaattatattttgtgccccatcgggctcgggtaaaactaccattgtt
aagcatctacttgacaaatacacaaatctcggtttttcaatttcagcatgtactcgcgat
aaacgcgggcgtaatgaagaaaacggcaaagattattatttccttagtattcatgatttt
aaagaaagaattgatagagatgaatttgtagaatggcaagaagtatacccaggagcttat
tatggtacactaaaaactgaaatcgaacgcctgtgggatgaaggcaaaaatgtaattttt
gatgtggatgtaaagggcggaatgaatctgaaaagatacttcggcgacaacgctttggca
atttacgtaaaagtgccttcgatggaagaattggaaagaagattacgcagccgtggcact
gacgatgaagatagcatttctagaagaatctataaaatgaagttcgagatggagtttcaa
gataaattcgatgtcattttgcacaatgatgatatccaacattcttggcaaaaagccgaa
gaactctacgagcaatttactaaaaatgagttagtgattacaaaaaaaccgttggaagtg
tga

DBGET integrated database retrieval system