KEGG   Emticicia oligotrophica: Emtol_1769Help
Entry
Emtol_1769        CDS       T02272                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-d iaminopimelateligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eol  Emticicia oligotrophica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eol00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eol00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1726448..1727899)
Genome map
AA seq 483 aa AA seqDB search
MVLSEVLYKVSLQAVSGKTDIEIKDIIFDSRQVKKGSLFVAIGGTQVDGHNFIEKAIELG
ASAILCERMPENLNENITYVQVENSARAMGFAAANFYGNPSQKLKLVGVTGTNGKTSTVT
LLFRLFRKLGYRCGLLSTVQNQIDDDIIPSTHTTPDSVKINELLADMLQKGVTYCFMEVS
SHSVVQERIAGLYFAGGIFTNITHDHLDFHGTFDNYLKAKKGFFDQLPASAFALVNTDDK
NGKIMLQNTVARKETYSLKNIGTFKGKVLACSLFGLQMEIDNKEVWFKLIGSFNAYNLLG
VYGAAVLLGENSEEVLMQLSDIQPPAGRFEQVVSKNNIVGIVDYAHTPDALKNVLETIVD
LREGNQQIITVVGCGGNRDAAKRPIMAEIACKLSDKVILTSDNPRNEDPMDILGQMQKGV
PPLHFKKTQTIEDRHEAILIAVKMAKPEDIILVAGKGHETYQEIKGVKHHFDDKEVLKEA
FGE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtattaagcgaagttctttacaaagtctctcttcaggcagtttctgggaagacagat
atagaaataaaagacattatattcgattcccgtcaagtaaaaaagggaagtttattcgtt
gctatcggcggaacgcaggtagatggacataactttattgagaaagcgattgaactcggt
gcttcggcaattttatgcgagcgaatgcccgaaaatttgaatgaaaatatcacctacgta
caagtcgaaaattcggcacgagcaatgggttttgcagcggccaatttttatggaaatcct
tcacaaaaactaaagctagtaggggtaacaggtacaaacggtaaaacttctacagttacg
ctacttttccgtttattccgtaaattaggttatcgttgtggtttgctttcaacagttcaa
aaccaaatagacgatgatattattccttcaactcatacaacgccagattctgtaaaaatc
aacgaacttttggccgatatgcttcagaaaggagtaacctactgtttcatggaggtaagt
tcgcattcggttgtgcaggagcgtattgcgggtttgtattttgctggtggaatttttaca
aatataacccatgaccacctcgattttcatgggacattcgataattacctaaaagctaag
aaaggtttttttgaccaacttcctgcttctgcttttgccttggttaataccgatgacaaa
aacggaaaaataatgctccaaaatacggtagctcgtaaagaaacttattctttgaaaaac
atcggtactttcaaaggaaaggtattggcatgtagcctttttggccttcaaatggaaatt
gataataaagaagtttggtttaaactgataggttcattcaatgcttacaatttgttgggt
gtttatggagcggctgttttattgggcgaaaactcagaagaggttttgatgcaattatct
gatattcagccacctgctgggcgttttgaacaagttgtttcaaaaaataacatcgtcgga
atcgttgattatgctcatacaccagatgctctgaaaaacgtgttagaaaccatcgttgat
ttgcgagaaggcaatcagcagataattacggttgtgggttgtggaggaaatagggatgcc
gctaaacgcccgattatggccgaaattgcttgtaaattgagtgataaggttattctcacg
tcagataatccaagaaatgaagacccaatggatattttaggccaaatgcaaaaaggtgta
cctccgcttcatttcaaaaaaacacagactatcgaagaccgccacgaagcaattttaatc
gcagtaaaaatggcaaaacccgaagatattattttggtagcaggcaaaggccacgaaacc
tatcaagaaatcaaaggtgttaaacatcatttcgatgataaagaagtattgaaagaggct
tttggcgaataa

DBGET integrated database retrieval system