KEGG   Emticicia oligotrophica: Emtol_2000Help
Entry
Emtol_2000        CDS       T02272                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eol  Emticicia oligotrophica
Pathway
eol00071  Fatty acid degradation
eol00280  Valine, leucine and isoleucine degradation
eol00281  Geraniol degradation
eol00310  Lysine degradation
eol00360  Phenylalanine metabolism
eol00362  Benzoate degradation
eol00380  Tryptophan metabolism
eol00410  beta-Alanine metabolism
eol00640  Propanoate metabolism
eol00650  Butanoate metabolism
eol00903  Limonene and pinene degradation
eol00930  Caprolactam degradation
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Emtol_2000
   00650 Butanoate metabolism
    Emtol_2000
  Lipid metabolism
   00071 Fatty acid degradation
    Emtol_2000
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Emtol_2000
   00310 Lysine degradation
    Emtol_2000
   00360 Phenylalanine metabolism
    Emtol_2000
   00380 Tryptophan metabolism
    Emtol_2000
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Emtol_2000
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Emtol_2000
   00281 Geraniol degradation
    Emtol_2000
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Emtol_2000
   00627 Aminobenzoate degradation
    Emtol_2000
   00930 Caprolactam degradation
    Emtol_2000
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Emtol_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFK03140
UniProt: I2ETY7
Position
2012139..2012945
Genome map
AA seq 268 aa AA seqDB search
MQTLQLIIENNIARVTINRPEKANALNQTAWDEIKGVFESLDENPEVRVIVLDGGESKHF
CAGIDLSLLMSVSQTNIACDARRRERVRKDVLRLQAPIDAIENCSKPVLAAIHGGCIGGG
IDLICACDMRYCTDDAYFTIKEIDMGMVADLGTLQRLPKIIGDGLVREMAYTGRNVEGKE
AEKIGIVNRSFTDKESMMTEVMKIAAMIASKSPLSIRGTKHILLHTRDHSVADGLNYMAT
WNAAMLLSNDLKEAFSAKLEKRNTNFED
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcttcaactaatcatagaaaacaacattgctcgtgtaactatcaatcgacca
gaaaaagccaacgctctcaaccaaacagcatgggacgaaataaaaggagtttttgaaagc
cttgacgaaaaccctgaagtaagagtaattgtgcttgatggaggagaaagcaaacacttt
tgtgcagggatagatttgagtttattgatgtcggtttctcaaacaaatatcgcttgcgat
gcccgtcggcgtgagcgtgtacgtaaagatgtattgcgtttacaggcaccgattgatgct
attgaaaattgctcaaaaccagttttggcggccattcatggtggttgtattggtggagga
atagatttaatctgtgcctgtgatatgcgttattgtacagatgatgcctattttactatc
aaagagatagatatgggaatggtggcagatttgggcactttacagcgtttaccaaagatt
attggcgatggtttggtgagagaaatggcctacacaggcagaaatgttgaaggaaaagag
gctgagaaaatcggtatagtcaatcgctcgtttactgataaagaatcaatgatgacagaa
gtgatgaaaatagcggcaatgattgcttctaaatcacccttatctattcgtgggactaaa
catattttacttcacactcgcgatcactctgtggcggatgggctgaattatatggccact
tggaatgcggctatgctactttcaaatgatttaaaagaagctttctctgcaaagttagaa
aagcgtaatacaaattttgaagattga

DBGET integrated database retrieval system