KEGG   Emticicia oligotrophica: Emtol_2021Help
Entry
Emtol_2021        CDS       T02272                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridin epyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eol  Emticicia oligotrophica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Emtol_2021
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Emtol_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2041033..2041524
Genome map
AA seq 163 aa AA seqDB search
MKPHKVFLGLGSNLGNREENLRNAIIRIRDIIGAITQESGIYETVAWGLTDQNAFLNQVI
AIETSYSPIAVLHLILRIEREMGRIREVKWGARIIDIDILYYDDEMILTENLSIPHPFIQ
ERKFVLVPLCEISPENIHPILKQTNHQLLLACQDSGEVNKVIN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccacacaaagtttttcttggattaggctcaaatttaggtaatcgtgaagaaaat
ttacgaaatgccattattcgtatcagagatataatcggagctattacgcaagaatcgggc
atttacgaaactgttgcttggggcttaaccgaccaaaatgctttcttgaatcaagtaatt
gccattgagaccagctattcacccatcgcagtattacatctcattcttcgtattgagcgt
gaaatgggtcgaattagagaggtaaaatggggggctcgtatcattgatattgatattctt
tactacgatgacgagatgattttaaccgaaaatcttagtattccccacccatttattcaa
gaacgtaagtttgtgttagttcctttgtgtgaaatctctcccgaaaatatccaccctata
ctcaagcaaactaatcatcaattattattggcgtgccaagattcgggtgaagtgaataag
gttattaattga

DBGET integrated database retrieval system