KEGG   Emticicia oligotrophica: Emtol_2086Help
Entry
Emtol_2086        CDS       T02272                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eol  Emticicia oligotrophica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_2086
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emtol_2086
Enzymes [BR:eol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Emtol_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2123342..2124130
Genome map
AA seq 262 aa AA seqDB search
MTILDKINAQKIIEVAEAKASVSIEDLKASQFFSRKTNSLVASLLAEGSTGIISEHKRKS
PSKGVINDQLSVEEVTQGYAQAGAAGLSVLTDKDFFGGSKEDLQKARLANPSTPILRKDF
MIDAYQVYEAKAWGADVILLIAASLSPQQIQDLSQKAHELGLEVLLEVHDQEELDRSPLA
HVDLVGVNNRNLKNFAENNVNASLELADKIPANIIKISESCISQPETINQLKAVGYKGFL
IGETFMKDANPGTKLAEFIAKI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactattttagataaaattaatgcccaaaagataatcgaagtggccgaagccaaagca
agcgtttctattgaagatttaaaagccagtcaattcttcagtagaaaaaccaactcgctt
gtggcaagtcttttggctgaaggctctactggaatcatttcggagcataaacgtaaatct
ccttccaaaggcgtaattaatgaccaactctctgttgaagaagttacacagggatacgcc
caagcaggagcagcaggtttatcggtgctaacagataaagatttttttggtggttcgaag
gaagatttacaaaaagcacgtttagctaatccgagtacgccaattcttcgcaaagatttc
atgattgatgcatatcaagtatatgaagccaaggcttggggagcagatgtaatcttatta
attgcggcaagcctatcgccacaacaaattcaagatttaagtcaaaaagcacatgaactt
ggtttggaggtattactcgaagtacatgaccaagaagaattagaccgtagtccgctagct
catgtagacctcgttggcgtgaataatcgaaaccttaaaaactttgctgaaaataatgtc
aatgcttctttagaattggccgataaaattccggcaaacattattaagatttcagaaagt
tgtattagccagcccgaaacaatcaatcaacttaaggctgtggggtataaaggcttcctg
attggagaaactttcatgaaagatgcaaatccgggaacaaaactggccgaatttatagcg
aaaatctaa

DBGET integrated database retrieval system