KEGG   Emticicia oligotrophica: Emtol_2088Help
Entry
Emtol_2088        CDS       T02272                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eol  Emticicia oligotrophica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_2088
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emtol_2088
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emtol_2088
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Emtol_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2124877..2126070
Genome map
AA seq 397 aa AA seqDB search
MTAVKQSSYAVNAKGYYGKFGGAYIPEMLYPNIEELQNNYLEIIYQPEFQAEFHALLKDY
VGRPTPLYFANRLSEKYQTNVYLKREDLCHTGAHKVNNTIGQILLAKRLGKNKIVAETGA
GQHGVATATVCALMGLECIVYMGEIDIQRQAPNVARMKMLGAEVRPATSGSKTLKDATNE
AMRHWINNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIRSQLLEKIGSETPDYVIACV
GGGSNAAGAFYHFLDEPSVKLIAAEAGGHGIHSGMSAATTFLGKEGVLHGSKSILMQTED
GQVVEPHSISAGLDYPGIGPMHAHLWDSGRAKFYAITDDESIKAGFELAKLEGIIPAIES
SHALAVLPYLKAGANETVVINLSGRGDKDLDTYMKYL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtaaaacaatcatcctatgccgtaaatgcaaaaggttattacggcaagttc
ggtggagcatatattcctgaaatgctttatccgaatattgaggaactccaaaataactat
cttgaaattatctatcaaccagaatttcaggctgagtttcatgcacttctcaaagattac
gtaggtcgtccaactcccttatattttgctaatcgtttatcggaaaaatatcaaacaaat
gtttatctaaaacgtgaagacctttgtcatacaggtgcacacaaggtaaataatacgatt
gggcaaattcttctagctaaaagattaggtaaaaataaaatcgttgccgaaacaggtgcg
gggcagcacggagtagctactgccacggtttgtgccttaatgggccttgaatgtattgtg
tacatgggcgaaatagatattcaacgccaagcacccaatgttgcacgtatgaaaatgctt
ggtgcagaagtacgtcctgccacaagtggttcaaaaacgctcaaagatgctactaacgaa
gccatgcgtcactggattaataatcctgtcgatacacattatattataggttcggtagta
gggccgcatccatacccagatatggttgcacgctttcagtcggttatttcggaagaaatc
cgtagccaattgcttgaaaaaataggttcagaaacacctgattacgtaattgcttgcgta
ggtgggggttcaaatgctgcgggtgcattctatcattttcttgatgaaccttcagtaaaa
ctcattgctgccgaagcaggtgggcatggtattcattctggaatgtcagccgctactacc
tttttaggtaaggaaggtgtccttcacggaagtaaaagtatcttgatgcaaactgaagat
ggccaagtagtagaaccacattctatttcagcgggtcttgactaccccggtattggccca
atgcatgctcacttatgggattctggtagggcaaagttctatgctattaccgatgatgaa
tcaatcaaagcaggttttgagttagccaaacttgaaggtattattcctgcgattgagtct
tctcatgcactggcagttttaccatatttaaaagcaggggctaacgaaacggttgttatt
aacctttctggacgaggcgataaagacttagatacttacatgaagtatttataa

DBGET integrated database retrieval system